KEGG   Halorubrum lacusprofundi: Hlac_3558
Entry
Hlac_3558         CDS       T00856                                 

Name
(GenBank) Protein-tyrosine phosphatase, low molecular weight
  KO
K03741  arsenate reductase (thioredoxin) [EC:1.20.4.4]
Organism
hla  Halorubrum lacusprofundi
Brite
KEGG Orthology (KO) [BR:hla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hlac_3558
Enzymes [BR:hla01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.4  arsenate reductase (thioredoxin)
     Hlac_3558
SSDB
Motif
Pfam: LMWPc
Other DBs
NCBI-ProteinID: ACM59065
UniProt: B9LX74
LinkDB
Position
pHLAC01:complement(305731..306114)
AA seq 127 aa
MAAAFAEQERDRRGVGDRIEIVTGGTQPADHVHDIVVEAMAEVDIDISDRTPREVTPDEL
QAIDLVVTMGCSASDVCPATWNGENRDWGLDDPHGRPIEEVRAIRDEIAERVDAVFDDAV
PESVSME
NT seq 384 nt   +upstreamnt  +downstreamnt
atggccgccgcgtttgccgagcaggaacgcgaccgacgcggcgtgggtgaccggatcgag
atcgtcaccggcgggacacagcccgcggatcacgtccacgacatcgtcgttgaggcgatg
gcagaagtggacatcgacatcagcgaccggacgccccgagaggtgacccccgatgagcta
caagcgatcgacctcgtcgtcaccatgggctgttcggcctcggacgtgtgcccagcgacg
tggaacggcgagaaccgtgactgggggctcgacgatccacatggacgtccgatcgaggag
gtccgcgctatccgcgacgaaattgcggaacgcgtcgatgcggtgttcgatgacgctgtc
ccggaatcggtatccatggaatga

DBGET integrated database retrieval system