KEGG   Hydra vulgaris: 105846314
Entry
105846314         CDS       T01080                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hmg  Hydra vulgaris
Brite
KEGG Orthology (KO) [BR:hmg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hmg04052]
    105846314
   00536 Glycosaminoglycan binding proteins [BR:hmg00536]
    105846314
Cytokines and growth factors [BR:hmg04052]
 Growth factors
  Growth factors (RTK binding)
   105846314
Glycosaminoglycan binding proteins [BR:hmg00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105846314
SSDB
Motif
Pfam: FGF Fascin DUF4082 FRG1
Other DBs
NCBI-GeneID: 105846314
NCBI-ProteinID: XP_012560378
LinkDB
Position
Un
AA seq 210 aa
MNRELIKGVIIYMNLIFLGSASKPLLTIEKIEESINKEWMTAQKSNWQQSKQSKPILVNK
GISYSLNQWTNCRVIYARCRNGLDLAVVNRKVVGINSPYSINGIFEIQSYGTSVVMLKHA
ETNKYLAMDKKGNIQIMATKSDETLFYHYLEENGYITFASVKYYINEYYDLFLSLRKNGK
IRKANRTAAGQSASQFLLIPTNTSRSCVRK
NT seq 633 nt   +upstreamnt  +downstreamnt
atgaacagagaattgattaaaggtgtcattatatatatgaacctgatatttttgggaagc
gcatccaaaccgttattaactattgaaaagatagaagaatctattaacaaagaatggatg
acagctcaaaagtctaactggcaacaatcaaaacaaagtaagccaattcttgttaacaaa
ggtatttcttactctttaaaccaatggacaaactgtcgtgtcatttatgctcgctgcaga
aatggtttggatcttgctgttgtaaatcgcaaagttgttggcattaattctccatacagt
attaatgggatattcgagatacaatcttatggtacaagcgtggtaatgctaaaacacgct
gaaaccaacaaatacctggcaatggataaaaaaggaaacatccagataatggcaacaaag
tctgacgagaccttgttttatcactacctagaagagaatgggtatataacatttgcctct
gtaaagtattacattaacgagtactatgatttattcttaagcttgcggaaaaacggaaaa
attcgtaaagcaaaccgaacagcagccggtcagtccgcttctcaatttttacttatacca
actaatactagtagaagttgtgttcgtaaatag

DBGET integrated database retrieval system