KEGG   Hydrocarboniclastica marina: soil367_18850
Entry
soil367_18850     CDS       T06192                                 

Definition
(GenBank) DUF4400 domain-containing protein
Organism
hmi  Hydrocarboniclastica marina
SSDB
Motif
Pfam: DUF4400 PolyA_pol_arg_C
Other DBs
NCBI-ProteinID: QCF28131
UniProt: A0A4P7XLS3
LinkDB
Position
psoil36-7:98779..99396
AA seq 205 aa
MSRGFFVVLVVTIELMLIATLIPGDWAQQAIEKEAAYIANSSGLEHRDFILGKATGWYTS
ATIETGMWQAVYDFLIPTEQQRAESAIQADWWFSFLEGRIESLQKSVYHTMTRFALLLSW
LPYILIILLPAAWDGLMTWKIKKTNFDYSSPVIHRYSIKAGATIVAVVLLAFFAPVPIDP
IYIPAALMIIAIIAGIAIGNLQKRI
NT seq 618 nt   +upstreamnt  +downstreamnt
gtgagcagaggcttctttgttgttctggtcgtgaccattgagcttatgctcatagccacc
ctgataccgggcgactgggcacagcaggcgatcgagaaagaggctgcgtatatcgcgaac
tcgtcaggcctagagcaccgcgactttattctggggaaagctaccggttggtacacgtcg
gccacaattgaaactggaatgtggcaggcggtatatgattttctgattccaacagaacag
cagcgggctgaatccgctatccaggcggactggtggttcagctttctggaagggcggatc
gagtcgctgcaaaagtccgtttaccacactatgaccaggtttgcgctccttttgagctgg
cttccctatatcctgataattctgcttccagctgcatgggatggcttgatgacctggaaa
ataaagaaaacaaacttcgactactccagtccggtaattcatcgatacagcatcaaggca
ggggccacgatcgtagctgtagtcttgctcgccttctttgcaccagtcccaatagaccca
atctacattcctgccgccctgatgattatcgcgatcatcgctggcatagccattggaaac
ctccagaagcgcatctga

DBGET integrated database retrieval system