KEGG   Helicobacter pylori oki422: HPOKI422_03345Help
Entry
HPOKI422_03345    CDS       T03726                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hpyf  Helicobacter pylori oki422
Pathway
hpyf00473  D-Alanine metabolism
hpyf00550  Peptidoglycan biosynthesis
hpyf01100  Metabolic pathways
hpyf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hpyf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    HPOKI422_03345
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HPOKI422_03345
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    HPOKI422_03345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hpyf01011]
    HPOKI422_03345
Enzymes [BR:hpyf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     HPOKI422_03345
Peptidoglycan biosynthesis and degradation proteins [BR:hpyf01011]
 Precursor biosynthesis
  Amino acid ligase
   HPOKI422_03345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATPgrasp_TupA RimK VitD-bind_III ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AHN40425
LinkDB All DBs
Structure
PDB: 

Position
complement(656944..658014)
Genome map
AA seq 356 aa AA seqDB search
MQSFLGSLIVEFCVLFGGASFEHEISIVSAIALKGVLKDRIKYFIFLDENHHFYLIEESN
MHSKYFAQIKEKKLPPLILTHNGLLKNSFLGAKIIELPLVINLVHGGDGEDGKLASLLEF
YRIAFIGPRIEASVLSYSKYLTKLYAKDLGVKTLDYVLLNEKNRANALDLIGFNFPFIVK
PSNAGSSLGVSVVKEEKELIYALDSAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSY
VEEPNKQEFLDFKQKYLDFSRTKAPKANLSNALEEQLKENFKKLYNDLFDGAIIRCDFFV
IENEVYLNEINPIPGSLANYLFDDFKTTLENLVQSLPKTPKIQIKNSYLLQIQKNK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcgtttttagggagtttgatcgtggagttttgcgttttatttggtggggcgagt
tttgagcatgaaatcagcattgtgagtgcgatcgcgcttaaaggagtgttaaaagacagg
attaaatattttatttttttagatgaaaaccatcatttttatttgattgaagaatccaac
atgcattcaaaatacttcgctcaaatcaaagaaaaaaaattaccccccctaatcctcaca
cacaatggcttgcttaaaaactcgtttttaggggctaagattatagaattgcctttagtg
atcaatctcgtgcatgggggcgatggcgaagacgggaaattagcgagcttgttagaattt
tatcgtatcgcttttataggccctaggattgaagcgagcgtgttgagttatagcaaatat
ttaaccaagctttatgccaaagatttaggggtgaagactttagattatgttcttttgaat
gaaaaaaaccgcgctaacgccttggatttgattgggtttaatttccctttcattgtgaaa
cccagtaacgccggaagctctttaggagtgagcgttgtgaaagaagaaaaagaattgatt
tacgctttagacagtgcgtttgaatattctaaagaagttttaatagagcctttcattcag
ggcgtgaaagaatacaatttagccggctgtaagatcaaaaaggatttttgtttttcctat
gtggaagagcctaacaaacaggaatttttagatttcaaacaaaaatatttggatttttca
cgcaccaaagcccctaaagcgaatctttctaacgccctagaagagcaattaaaagaaaat
tttaaaaaactctataacgatttgtttgatggcgcgatcattcgttgcgatttttttgtc
atagaaaatgaagtgtatcttaatgagatcaaccccattcctggcagtttggccaattat
ttgtttgatgattttaaaacaactctagaaaatttagtgcaatcattacccaaaacccct
aaaatccaaatcaaaaactcttatttgttgcaaatccaaaagaataagtaa

DBGET integrated database retrieval system