Helobdella robusta: HELRODRAFT_80663 Help Entry HELRODRAFT_80663  CDS       T03272                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism hro  Helobdella robusta Pathway hro03022   Basal transcription factors hro03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:hro00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     HELRODRAFT_80663   09124 Replication and repair    03420 Nucleotide excision repair     HELRODRAFT_80663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:hro03021]     HELRODRAFT_80663    03400 DNA repair and recombination proteins [BR:hro03400]     HELRODRAFT_80663 Transcription machinery [BR:hro03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      HELRODRAFT_80663 DNA repair and recombination proteins [BR:hro03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      HELRODRAFT_80663 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  20215834 NCBI-ProteinID:  XP_009018870 JGI:  Helro1_80663 UniProt:  T1G436 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MVYVLKGVLVECDPPMKQLLLKLNETKALGETFVLSDLDDSHLFIDSRFVKALQDKIDET MDKIHFPLEASNLESFN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggtgtacgttctgaagggagttctcgtcgaatgtgacccacccatgaaacagttattg ctgaagttgaatgaaacaaaggctctgggtgaaacatttgttctcagtgatttggacgac tcgcatctcttcatcgactccagatttgtaaaggctcttcaagataagattgatgaaacc atggacaaaatacactttcccttggaagccagcaatttggaatcatttaattaa

DBGET integrated database retrieval system