Hypericibacter terrae: FRZ44_15770 Help Entry FRZ44_15770       CDS       T06396                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism htq  Hypericibacter terrae Pathway htq01100   Metabolic pathways htq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:htq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRZ44_15770 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRZ44_15770 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QEX16284 UniProt:  A0A5J6MFK4 LinkDB All DBs Position 1703638..1703871 Genome browser AA seq 77 aa AA seqDB search MSDIAERVKKIVVEHLGVDESKVTEGAHFIDDLGADSLDIVELVMAFEEEFGCEIPDDAA EKVLTVKDAITFIEQHS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccgagcgcgtgaagaagatcgtcgtcgagcacctcggcgtcgatgag tccaaggttaccgaaggtgcgcatttcatcgacgacctgggcgccgacagtctcgacatc gtcgagctggtgatggcgttcgaagaagagttcggttgcgaaattcccgacgacgccgcg gagaaggtgttgacggtgaaggacgcgatcaccttcatcgagcagcacagctga

DBGET integrated database retrieval system