KEGG   Halomonas venusta: EI420_10010
Entry
EI420_10010       CDS       T05892                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
hvn  Halomonas venusta
Pathway
hvn00230  Purine metabolism
hvn00240  Pyrimidine metabolism
hvn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EI420_10010
   00240 Pyrimidine metabolism
    EI420_10010
Enzymes [BR:hvn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     EI420_10010
    3.2.2.-  
     EI420_10010
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AZM95998
UniProt: A0A3Q8WG65
LinkDB
Position
2099443..2100825
AA seq 460 aa
MTQPPVPRATISSIISPEGSLEVLSQHEVNRLKSTSKSGLHDLLRRCALAVLNCGSPTDD
SLAIMEAYKDFDIEVLQQDRGIRLKLTNAPAEAFVDGRMIRGIREHLSSILRDIVYVYNE
IQHHKRFDLTTGEGTTNAVFHILRKAGTLKPGRDPSLVVCWGGHSISREEYEYTKDVGYH
LGLRDLDICTGCGPGAMKGPMKGANVAHAKQRRKDGRYLGISEPGIIAAEAPNPIVNELV
VMPDIEKRLEAFVRLGHGIIVFPGGVGTAEEILYLLGILLHPSNHDIPYPLVFTGPADSA
EYFQKIDEFLVYTLGEDIRRYYTIITGNPVAVARKMREEIDAIADFRRKHQDAFYYNWRL
TIARDFQAPFEPTHEAMRGLALHRQQPTHELAANLRRAFSGIVAGNVKEPGIRAIEAHGP
FELTAEPELMQRLDELLTSFVAQGRMKLDGQAYTPCYVLK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgacgcaacctccagtgccgcgtgccaccatttccagcattatttccccggaaggcagc
ctcgaagtgctttcccagcatgaggttaaccgcttaaaaagcacctctaaaagtggcttg
catgatctgctacgccgctgtgcacttgcggtgcttaactgcggcagcccaacggatgat
agtttggccattatggaagcctacaaagactttgatattgaagttttacagcaagaccga
ggcatacgtcttaagctaaccaatgcgcccgccgaagcctttgtcgacggacgaatgatt
cgtggtatacgtgaacacttatcatcaattcttcgtgacatagtttatgtttacaacgag
atccaacaccacaagcggtttgacttaaccacgggcgaaggcacaactaacgccgtgttt
catatcctgcgcaaggcgggcacgctaaagcccggacgcgatccaagtttggtggtgtgc
tggggtggccactcgatttccagagaagagtatgaatataccaaggacgttggttatcac
cttggcttgcgtgatttagacatctgtaccggctgcggccctggcgccatgaaaggcccc
atgaaaggcgctaacgttgcccatgcaaaacagcgtcgtaaagatggccgctatttgggc
atttctgaaccaggcattattgcagccgaagcgcccaaccctatcgttaacgagctggtt
gtcatgccagacatcgagaaacggctcgaagcattcgtgcgcttagggcacggtattatt
gttttccccggaggcgtaggtactgcagaagaaattctttacctgctgggaattctgctt
catccaagcaatcacgatattccttatccgctcgtgtttaccggccctgccgattccgct
gagtactttcagaaaatcgatgaatttttagtctatacgctgggcgaggatatccgccgc
tactacacgattattaccggcaaccctgtggccgtcgcacgtaaaatgcgtgaagagatt
gacgcgattgccgacttccgccgcaagcatcaggatgctttttactacaactggcgcctt
accattgctcgcgactttcaggcacccttcgaacccacccatgaagctatgcgtggtcta
gcgcttcatcgtcagcagcctacccatgaactagcggccaacttacggcgtgctttttcg
ggcattgtggcgggtaacgttaaagaaccagggattcgagcaattgaagcccatgggcct
tttgagttaaccgcggaaccagaactcatgcaacgcttagacgagctattaacctcattt
gtcgcccaaggacgcatgaaacttgatggacaagcatatacaccctgctatgttctaaag
taa

DBGET integrated database retrieval system