KEGG   Hydrogenophaga sp. LPB0072: LPB072_15795Help
Entry
LPB072_15795      CDS       T04505                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
hyl  Hydrogenophaga sp. LPB0072
Brite
KEGG Orthology (KO) [BR:hyl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LPB072_15795
Enzymes [BR:hyl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LPB072_15795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 Thi4 K_oxygenase FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOW15708
UniProt: A0A167J1Y8
LinkDB All DBs
Position
complement(3440690..3442270)
Genome map
AA seq 526 aa AA seqDB search
MLDSTLTSQLSSYLAMLRQPIRLIASLDDSAKAGEMRELLGEIAALSDKVSFDESGSDAR
KPSFVIAKEGETSGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEPEVIEQIKALEGEHRF
EVYMSLSCHNCPDVVQAASLMAIVNPNIQTVVIDGGLFQEEVERRQVLAVPLMYRNGEVF
GSGRMLLEEIVAKLDVKSDEREAARLNEKDPFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQVNDTMAIENYISVLETDGPKFAAALEAQVRHYDVDIMNLQRADKLLPASEPGG
LIEVQLANGGTLKSKTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRVSVI
GGGNSGVEAAIDLAGLVAHVTLVEFADALKADAVLVSKLKSLPNVTIHVNAQTTEITGTD
GKVNGLRYKDRVSGVETLVELEGVFVQIGLVPNTEWLKGDVNLSRFGEIEIDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGDGSKAALSAFDYLIRQPVVLDAVDA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcttgactcgaccctcacttcccagttgtcttcttatctggccatgctgcgccagccc
atccggttgattgcttcgctggatgacagcgccaaggcgggcgagatgcgcgaactgctg
ggtgagatcgcggccttgtctgacaaggtgagttttgacgaatcgggatccgacgcccgc
aagccttcgtttgtgattgccaaggaaggcgaaacctcaggcgtgcgttttgcggcgatc
ccgctgggccacgagttcacttcgctggtgctggccttgctgtggaccggcggtcatccg
cccaaggtcgagccggaagtgatcgagcagatcaaggcactggaaggcgagcaccgcttc
gaggtctacatgagcctgtcgtgccacaactgccctgatgtggttcaggccgccagcctg
atggcgatcgtgaaccccaacatccagaccgtggtgatcgacggcggcctgttccaggaa
gaggtcgagcgccgccaggtgctggccgtgccgctgatgtaccgcaacggcgaggtgttt
ggttcgggccgcatgttgctcgaagagatcgtggccaagctggacgtgaagtccgacgag
cgcgaggccgccaggctcaacgagaaagacccgttcgatgtgttgatcgtcggcggtggc
ccggccggtgcggcagctgcggtgtacgcggcgcgcaaaggcatccgggtcggcgtggcg
gccgagcgttttggtggccaggtcaacgacacgatggcgatcgagaactacatcagcgtg
ctggaaaccgacggtcccaagtttgccgcggcgctggaagcgcaggtgcgccactacgac
gtggacatcatgaacctgcagcgcgccgacaagctgcttccggccagcgaacctggtggc
ctgatcgaggtgcaactggccaacggcggcacgctcaagagcaagaccgtgatcctgtcc
accggcgcgcgctggcggaacgtcaacgtgcccggcgagcaggaatacaagaacaagggc
gtggcctactgcccgcattgcgatggcccgctgttcaagggaaagcgcgtatcggtgatc
ggcggcggcaactcgggcgtggaagcagccatcgacctggccggcctcgtggcccatgtg
acgctggtggaattcgccgacgcgctcaaagccgatgcggtgctggtcagcaagctcaag
agcctgccgaatgtcaccatccatgtgaacgcccagaccaccgagatcaccggcaccgat
ggcaaggtcaacggcctgcgctacaaggaccgcgtgagtggcgtggaaacactggtggag
ctggaaggcgtgttcgtgcagatcggtctggtgcccaacaccgagtggttgaaaggtgat
gtgaatctgagccgttttggcgagatcgaaatcgatgcgaagggccacaccaacgtgcct
ggggtgttcgctgcgggtgactgcaccacggttccctacaagcaaatcgtgatcgccgcc
ggtgatggttccaaggccgcactgagcgcgttcgactacttgatccgccagcccgtggtt
ttggatgccgtagacgcctga

DBGET integrated database retrieval system