KEGG   Intestinimonas butyriciproducens: IB211_01884cHelp
Entry
IB211_01884c      CDS       T04182                                 

Definition
(GenBank) Butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
ibu  Intestinimonas butyriciproducens
Pathway
ibu00071  Fatty acid degradation
ibu00280  Valine, leucine and isoleucine degradation
ibu00410  beta-Alanine metabolism
ibu00640  Propanoate metabolism
ibu00650  Butanoate metabolism
ibu01100  Metabolic pathways
ibu01110  Biosynthesis of secondary metabolites
ibu01120  Microbial metabolism in diverse environments
ibu01130  Biosynthesis of antibiotics
ibu01200  Carbon metabolism
ibu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ibu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    IB211_01884c
   00650 Butanoate metabolism
    IB211_01884c
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IB211_01884c
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IB211_01884c
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IB211_01884c
Enzymes [BR:ibu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     IB211_01884c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Motif
Other DBs
NCBI-ProteinID: ALP94275
UniProt: A0A0S2W4R0
LinkDB All DBs
Position
complement(1864564..1865706)
Genome map
AA seq 380 aa AA seqDB search
MNFTLNENQLAIQSTVKAFAEKELAKDILVRDAAAEFPHDLYAKMGEMGLIGLPYPKEYG
GQGEDYLSYILAVEEVSKVDGAMGISYSVSTSLYGGSLTNSQATEEQLRRFLTPVASGKS
LGSFALTEPTAGSDVAGARTLAVRDGDDYVINGSKCFITNGPLSDYFAVYALTDKEAGPK
SMACFVVEKGTPGFVIGTRHNTMGLRSAMVCELYFTDCRVPVANMIAAPGKGFGLAMKTL
DGGRIGVGAQGLGIAEGAWEIARKYLMERQQFGKPLCKQQTIAFKMAELAIEIEQAKYMV
YKAALEKGEGQPYSISAAKAKYCGTNAAMHVTTEAVQLLGGNGYMKEFHVERMMRDAKIT
QIYEGTNEIQKMIVSGTLFK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaactttaccctgaacgaaaaccaactggccatccaatccacggtcaaggcgtttgcc
gaaaaggaattggccaaggacatcctggtacgggatgccgccgccgaattcccccatgac
ctgtatgccaagatgggggaaatgggcctaatcggcctgccctatcccaaggagtacggc
ggccagggcgaggattacctgtcctatatcctggcggtggaggaggtctccaaggtagat
ggagccatgggcatctcctactcggtctccacctccctgtacggcggttccctgaccaac
tcccaggccaccgaggagcagcttcgccgtttcctcacgccggtggcctctggcaagagc
ctgggctcctttgcgctgaccgagcccactgcgggctccgacgtggcgggcgcccgcacc
ttggcggtccgggacggcgacgattacgtcatcaacggttccaagtgcttcatcaccaac
gggccactgtccgactacttcgccgtgtacgccctcaccgacaaagaggcgggacccaag
agcatggcctgcttcgtggtggagaaggggacccccggctttgtcatcggtacccgccac
aataccatgggcctgcgcagtgccatggtctgcgagctctatttcacagattgccgcgtg
cccgtggccaacatgatcgccgcgccgggcaagggcttcggtctggccatgaagaccctg
gacggcggccgcatcggcgtgggcgcgcagggcctgggtatcgccgagggggcctgggag
atcgcccgcaagtatctgatggagcggcaacagtttggcaagcctttgtgcaagcagcag
accatcgccttcaagatggccgagctggccattgagatcgagcaggccaagtacatggtc
tacaaagccgccctggagaagggagagggccagccctactccatctccgccgctaaggcc
aaatactgcggcaccaacgccgccatgcacgtcaccaccgaggcggtccagcttctgggc
ggcaacggctatatgaaggagttccacgtggaacgcatgatgcgtgacgccaagatcacc
cagatttatgagggcaccaacgagatccagaagatgatcgtcagcggcacgctgttcaag
taa

DBGET integrated database retrieval system