KEGG   Intrasporangium calvum: Intca_0545Help
Entry
Intca_0545        CDS       T01385                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
ica  Intrasporangium calvum
Brite
KEGG Orthology (KO) [BR:ica00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ica01001]
    Intca_0545
Enzymes [BR:ica01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Intca_0545
Protein kinases [BR:ica01001]
 Serine/threonine kinases: Other
  Bacterial family
   Intca_0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR PknG_rubred Pkinase Pkinase_Tyr TPR_16 DZR TPR_21 WaaY
Motif
Other DBs
NCBI-ProteinID: ADU47090
UniProt: E6S9B4
LinkDB All DBs
Position
complement(591018..593501)
Genome map
AA seq 827 aa AA seqDB search
MTTSPPPTSTPPTSTGLRCAQPGCAGTIVDGYCDTCGMAPTSPAAPGGRSLADPGPPPAT
SPATSPATSPDTSLDTSLDTALATVPDGTPCAQPGCTGAIDDGYCNVCGTPAHQAEVVQV
VDSAVTRPAGMGSELSTRSAASSMLASAALGSKRARQTGSAVTRRTSGSQRLRSARLGGG
ITTVRPAPTIDAEKALLTDPVVPEAKRFCPKCGEPVGRGRDGQPGRTTGFCANCRHPFSF
DPKLRSGDLVAGQYEVAGCLAHGGLGWIYLARDKNVSDRWVVLKGLLNSADPDALAAAIA
EQRFLAQVSHPNIVEIYNFVTHDDAGYIVMEYVGGTSLKSILKQRMQRAGFYDPLPVDQA
LAYILEILPSFQYLHDLGLVYCDFKPDNIIQVGDEVKLIDLGGVRRVDDEDSAIFGTVGY
QAPEVADLGTSVASDIYTIGRTLVVLTMEFRGYQSTYLNVLPPQDSSPVFQKYDSFYRLV
SKACAPNRDDRFVSADELRSQMVGVLREVVAIDRGSGAATTTVGSLLFDAPTPGDEADDW
RNLPALRRDPHDAQTNWLHTISGSPEQRLDILRDAPARTAEVLLDLARTALSVGERDLAE
AAATELLTNDPWEWRAVWIQGLAALERGDAPSAQAAFNAVYGQVPGELAPKLALAHASEK
AGDDAVAENLYVACARTDSTYVPMAAFGLARIRAARGDVDGAVAAYRLVPTQSSAYRTAR
AGLAELLARANRGLPDLAEALRTLADTSLTARRRAEVTTHIYREALASVREAGAQPDLHL
GTHRATEPALRVGLEQALRELASRTPDTAERVALVDEANTVRPWSLW
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgagccccccgcccacgagcaccccgcccacgagcaccgggctccggtgcgcg
cagcccggctgcgcgggcacgatcgtcgacggctactgcgacacctgcggcatggcgccc
acgtctcccgcggccccgggcggtcggtccctcgccgacccagggccacccccggccacc
tccccggccacatccccggccacatccccggacacatccctggacacatccctggacacc
gcgctggccaccgttcccgacggcaccccgtgcgcgcagcccggctgcaccggcgcgatc
gacgacgggtactgcaacgtctgcggcaccccggcacaccaggcggaggtcgtccaggtc
gtcgactcggccgtgacccgaccagccggcatgggctcggagctctccacccggtccgca
gcctcgagcatgctcgcctcggcagcgctcggctcgaagcgcgcccgacagaccggctcg
gccgtcacccggcgcaccagcgggtcgcagcggctccgcagcgcccgcctcggcggcggc
atcaccacggtgcggcccgccccgaccatcgacgcggagaaggcactcctcaccgacccg
gtcgtccccgaggcgaagcgcttctgccccaagtgcggcgagccggtcggccgggggcgt
gacggccagcccgggcgcaccaccggcttctgcgccaactgccgccacccgttctccttc
gaccccaagctgcggtccggtgacctcgtcgccggccagtacgaggtcgccggctgcctg
gcccacggcggcctcgggtggatctacctcgctcgggacaagaacgtctccgaccgatgg
gtcgtcctcaagggcctgctcaactcggccgaccccgacgcgctcgccgcggccatcgcc
gagcagcgcttcctcgcccaggtgtcccacccgaacatcgtcgagatctacaacttcgtc
acccacgacgacgcgggctacatcgtcatggagtacgtcggcggcacgtcgctcaagtcg
atcctcaagcagcggatgcagcgcgcgggcttctacgatcccctgccggtcgaccaggcc
ctcgcctacatcctcgagatcctcccgtccttccagtacctccacgacctcggcctggtc
tactgcgacttcaagccggacaacatcatccaggtcggcgacgaggtcaagctgatcgac
ctcggcggcgtgcggcgggtcgacgacgaggactcggcgatcttcgggaccgtcgggtac
caggcgccggaggtggccgacctgggcacctcggtggcctcggacatctacaccatcggg
cgcaccctcgtcgtgctcacgatggagttccgcggctaccagtcgacctacctcaacgtc
ctgcccccacaggactcgagccccgtcttccagaagtacgactccttctaccggctcgtc
tccaaggcgtgcgcccccaaccgcgacgaccggttcgtgtcggctgacgagctgcgctca
cagatggtcggcgtgctccgcgaggtcgtcgccatcgaccggggctcgggggcagcgacg
acgaccgtcgggtcgctcctcttcgacgccccgacgcccggcgacgaggccgacgactgg
cgcaacctgccggccctccgacgcgacccccacgacgcgcagacgaactggctgcacacg
atcagcgggagcccggagcagcgcctcgacatcctccgcgacgcgccggcgcggacggcg
gaggtcctcctcgacctggcccggacggccctcagcgtcggtgagcgcgacctcgccgag
gcggcggccaccgagctgctcacgaacgacccgtgggagtggcgcgccgtgtggatccag
ggcctggcggcactcgagcggggcgacgccccctccgcgcaggcggccttcaacgccgtc
tacgggcaggtcccgggcgagctcgcccccaagctggccctcgcccacgccagcgagaag
gccggtgacgacgccgtcgccgagaacctctacgtcgcctgcgcccgaacggactccacc
tacgtgccgatggccgcgttcgggctggcccggatccgcgccgcccgcggtgacgtcgac
ggcgccgtggcggcctaccggctcgtccccacccagtcgagcgcctaccggaccgcccgg
gccgggctcgcggagctgctcgcccgggcgaaccggggcctgcccgacctcgccgaggcc
ctgcgcaccttggcggacacctcgctcacggcccggcggcgggccgaggtgacgacccac
atctaccgcgaggccctcgcctcggtgcgcgaagccggcgcgcagccggatctgcacctg
ggcacccaccgtgcgaccgagcccgccctcagggtcgggctggagcaggccctccgagag
ctcgccagccgcacgcctgacaccgccgagcgcgtcgcgctcgtcgacgaagccaacacc
gtccgaccttggagcctctggtga

DBGET integrated database retrieval system