KEGG   Intrasporangium calvum: Intca_1133Help
Entry
Intca_1133        CDS       T01385                                 

Definition
(GenBank) hypothetical protein
Organism
ica  Intrasporangium calvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL_3
Motif
Other DBs
NCBI-ProteinID: ADU47654
UniProt: E6SE41
LinkDB All DBs
Position
complement(1255639..1256715)
Genome map
AA seq 358 aa AA seqDB search
MRRSRATDVSLGLIALLINVAIVVAVVFFIGGDDAPPAASTLPTTTATPGSSSSAGMDGA
LPEVSRLLASDADLVLAVLGDGTGDEDGEWVSVLADLAGSTRQVTLRNLDPTDPTRYADE
QTYGTSGPTTVIWNGSRPGAGAGYAADRLDFLIPEEPDAVVLNYGRDDKASAIADRLDTT
LSAVRAKWPKVPIVVVLQAPNLNDQLAPVRKATEKWAAAKKLPTVDVAAAFRQAGDPNSF
VSVVDPPSVNAQGGLLWGETVYRAIGGRLPADSSSSSPPTVGAEATDVIAPGAAFPVGDS
SPVGAQPTPTAVSTTPPAPEPTPTETPVETSTTTFKPTRANPTTTTTEPETPPPAPAN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagatcccgggcgaccgacgtgtcgctggggctcatcgcccttctgatcaacgtg
gccatcgtcgtcgcagtcgttttcttcatcgggggggacgacgccccacctgcggcgagc
accttgccgaccacgaccgcgacccccggctcctcgagctccgcaggcatggacggtgcc
ctgccggaggtctcccggctgctcgccagcgacgcagatctcgtcctcgccgtgctcggc
gacggcaccggcgacgaggacggcgaatgggtgtcggtcctggccgacctggccggctcg
acacgacaggtcaccctgcggaacctcgaccccaccgacccgacccgctacgccgacgag
cagacctacggcacgtcggggccgacgacggtcatctggaacggcagccggcccggagcg
ggcgccggctacgccgcggaccgactcgacttcctcatcccggaggagcccgacgccgtc
gtgctgaactacggtcgggacgacaaggcctcggccatcgccgatcgcctcgacaccacg
ctctcggcggtccgggccaagtggcccaaggtgcccatcgtcgtcgtgctccaggcgccc
aacctgaacgaccagcttgcgcccgtgcgcaaggcgaccgagaagtgggcagcggccaag
aagctgccgacggtggatgtcgccgccgccttccgccaagccggggacccgaactccttc
gtctccgtcgtcgacccgccgagcgtcaacgcgcagggcggtctgctctggggcgagacc
gtctaccgcgcgatcggcggccggctccccgcggattcgtcctcgtcctcgccacccacc
gtcggcgccgaggcgaccgacgtcatcgcacccggtgcggccttccccgtcggtgacagc
agccccgttggcgctcagcccacaccgaccgcggtctccaccactccgccagcgcccgag
ccgaccccgaccgagactcccgtcgagacgtcaaccacgacgttcaagccgacccgggcc
aacccgaccaccacgacgactgagcccgagacccctccacccgccccggccaactga

DBGET integrated database retrieval system