Ipomoea nil (Japanese morning glory): 109187306 Help Entry 109187306         CDS       T04663                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini04136   Autophagy - other Brite KEGG Orthology (KO) [BR:ini00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     109187306  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ini04131]     109187306    04121 Ubiquitin system [BR:ini04121]     109187306    03029 Mitochondrial biogenesis [BR:ini03029]     109187306 Membrane trafficking [BR:ini04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     109187306 Ubiquitin system [BR:ini04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    109187306 Mitochondrial biogenesis [BR:ini03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     109187306 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 DUF4264 ATG8 Motif Other DBs NCBI-GeneID:  109187306 NCBI-ProteinID:  XP_019193030 LinkDB All DBs Position Un AA seq 90 aa AA seqDB search MTTESRKVIVHLRATGDAPILKQSKFKIGGNDKFAKVIDFLCRQLHRETLFVYVNSAFSP NPDELINDLYNNFGFDGKLVVNYACSMAWG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgactacggaatctcgtaaagtgattgttcatttgagagctactggtgatgctcctatc ctcaaacagtctaaattcaagattggtgggaatgacaagttcgctaaagtaattgatttt ctgtgccggcaactgcacagggagacgctgtttgtgtatgtcaacagtgccttctcacca aatccagatgagttgataaatgacctatataataactttggttttgatgggaagctggtg gtgaactatgcatgctccatggcatggggctaa

DBGET integrated database retrieval system