KEGG   Ipomoea nil (Japanese morning glory): 109193138Help
Entry
109193138         CDS       T04663                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini03030  DNA replication
ini03410  Base excision repair
ini03420  Nucleotide excision repair
ini03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ini00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109193138
   03410 Base excision repair
    109193138
   03420 Nucleotide excision repair
    109193138
   03430 Mismatch repair
    109193138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ini03032]
    109193138
   03400 DNA repair and recombination proteins [BR:ini03400]
    109193138
Enzymes [BR:ini01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109193138
    6.5.1.6  DNA ligase (ATP or NAD+)
     109193138
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109193138
DNA replication proteins [BR:ini03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109193138
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109193138
DNA repair and recombination proteins [BR:ini03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109193138
   NER (nucleotide excision repair)
    Other NER factors
     109193138
   MMR (mismatch exicision repair)
    Other MMR factors
     109193138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Presenilin
Motif
Other DBs
NCBI-GeneID: 109193138
NCBI-ProteinID: XP_019199515
LinkDB All DBs
Position
Un
AA seq 783 aa AA seqDB search
MLSLRSCSCYLPNTFIFFTRLHSHLTPNSIPFLLCAKPFFPKPLIFSANPNLRPMSTPRS
AFDVLMANSKKKSKTQTPPAQEPSPKKRKSAEKDTPEQKSSSVSAAIAENANSNVKAIEN
VDGARNGGEEVAAKKPKLISPDESVAELKKKGANFDPKKAAYWGDGERVPFMFVAKAFGA
IEEESGRIAITDIVANMLRTVIHTTPDDLLPAVYLSANKIAPAHEGLELGIGDASIIKAL
AEACGAKEAHIKKQYKDLGDLGLVAKASRSSQSLMRKPEPLTVAKVFSTFRLIAKESGKD
SQEKKKNYIKSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLVALSHATVYSEKHSSPPA
SVNSSIEEAEKIVKQVYSVIPVYDKIVPALLSGGVCNLQKTCSFSPGVPVGPMLAKATKG
VSEIVDKFQDKEFTCEYKYDGERAQIHYMENGSVEIYSRNAERNTGKFPDVVAAISRLKK
PSITSFVLDCELVAYDREKQKILPFQVLSTRARKNVVVSDIKVNVCIYAFDILYLNGQPL
IQEQLNVRREHLYSSFEEEPGYFQFATSTTSNDLEEITQFLEAAVNGSCEGLIIKTLSGD
STYEPSKRSHNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDSNNEEF
QSICKIGTGFSETMLEERSASHRSKVIPKPKSYYRYAETLDPDVWFEPTEVWEVKAADLT
ISPVHRAAIGIVDPEKGISLRFPRLIRIREDKTPEQASTAEMVADMYSAQKHNQQNNQDV
DEE
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgttatcactccgttcttgctcctgctacttgcccaacaccttcatcttcttcactcgc
ctccattctcaccttacacccaattcaattccatttctcctctgcgctaaacccttcttt
cctaaacccctaatcttctccgcaaaccctaatctcagaccaatgtccactcctcgctca
gcgttcgacgtcctcatggccaattccaagaagaaatccaagacccagacacctccggcc
caagagccttcgcccaagaaacgcaagagcgccgaaaaagacactccggagcagaagtct
agctctgtttcagcagctattgcggaaaatgccaattccaatgtgaaggcgattgaaaat
gtagatggggcgaggaatggcggggaggaagtggcagctaagaaaccgaagttgataagt
cctgatgagagcgttgcggagctgaagaagaagggggcgaattttgatccgaaaaaggct
gcgtattggggagatggggagagagtgccgttcatgtttgtggcgaaggcgtttggtgca
attgaagaggagtctgggcggattgccatcactgacattgtggccaatatgttaaggacc
gtgattcacaccacccctgacgacttgttgccggcggtgtacctttctgcaaacaaaatt
gcacctgcccatgagggattggaacttggaattggagatgcatcaattattaaggccctt
gccgaggcttgtggggctaaagaagcacacattaagaagcaatataaggatcttggtgat
ttaggccttgttgcaaaagcaagtcgatcatctcagtctttgatgcgtaaaccagaacca
ttaactgttgccaaagtttttagtacatttcggcttatagctaaggaatctggcaaggat
agtcaagaaaagaaaaagaattacatcaagtctctactagttgcagctactgattgtgaa
cctcagtatttgatccgactactacagacaaagttacgcatcggtttggcagaacaaact
cttttagtggcactgagccatgctacagtatactcagagaagcattcttcaccccctgca
agtgtgaattcatctatagaagaggctgagaagattgtaaaacaagtttactctgtgatt
cctgtatatgataaaattgttcctgctcttctttctggtggtgtctgtaaccttcaaaag
acatgctctttctcgcctggtgttccagttggacctatgctagctaaggcaactaaagga
gtatctgaaattgttgacaagtttcaagataaggagttcacttgtgaatacaagtatgat
ggtgagcgcgctcagattcattacatggaaaatgggtcagtggagatatacagcagaaat
gcagaacgtaatactggaaagtttcctgatgttgttgctgctatttctagattaaaaaaa
ccttctataacttcttttgttcttgactgcgaattagttgcatatgatcgtgagaaacag
aaaatcctgccttttcaggtcctcagtacacgtgctcgtaaaaatgttgttgtgagtgac
atcaaggtgaatgtttgcatctatgcctttgatatcttgtatcttaatggacaaccactt
attcaagagcagctcaatgttcgtagagagcatctctatagttcctttgaggaagaacct
ggctattttcaatttgccacgagtactacatcaaatgatctcgaggaaataacacaattt
cttgaagctgctgttaatggcagttgtgagggattgatcatcaaaacattgagtggagat
tcgacatatgagccttcaaaacgatcacataactggctaaaattgaaaaaagattacatg
gaaagtattggagactccctcgatttggtaccaatagctgcttttcatggccgagggaaa
cgtactggtgtttatggagcttttctccttgcttgttatgatagtaacaatgaggaattc
caaagcatttgtaaaatcggcactggtttttctgaaacaatgcttgaagaacgctctgcc
agccatcgttctaaagttatccccaagccaaagtcatattacaggtatgcagaaacactc
gatccagatgtatggtttgaacccactgaggtttgggaggtgaaagctgcggaccttaca
atcagccctgtgcaccgcgctgccattggtattgtggatcctgaaaagggaatttctctg
cgatttcctcgcttgattcgtattcgagaagacaagactccagaacaggcctcaacagca
gagatggttgcagatatgtattctgctcagaaacacaatcaacaaaataatcaggatgta
gatgaagagtga

DBGET integrated database retrieval system