KEGG   Ictalurus punctatus (channel catfish): 108258779
Entry
108258779         CDS       T04658                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
ipu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108258779 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108258779 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ipu04030]
    108258779 (LPAR2)
G protein-coupled receptors [BR:ipu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    108258779 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 DUF1634
Other DBs
NCBI-GeneID: 108258779
NCBI-ProteinID: XP_017313176
UniProt: A0A2D0Q644
LinkDB
Position
26
AA seq 381 aa
MAAVITATVATSPACPNYTVEDYYNLTQKLISKDWRPKDYAVVTLGLIVSCFIIVTNILV
MAAIFMNRRFHYPIYYLLGNLAAADLFAGISYMHLMFHTGPWTAKLTVYQWFLRQGLIDT
SLTASVINLMAIALERHQTIFTMQLHSKMTNTRVVLLILGIWTVAVLMGLIPSMGWNCLC
DTGNCSKMAPMYSRTYLVFWAVLNLLSFSVMVLVYTRIFIYVRHKSQRMSQHTVQNKHKE
TVENLMRTIFVILGCFVVCWTPGLVLLLLDGVKCNCGVLTVEKFVMILAELNSMMNPIIY
SYRDQDMRNTFKRILCWLCFRRGQMGQHADVHFNTLTQEVNRNKDAGENPTLLLQDSRKM
KNSTKTQLLKAQKPPKSVQNS
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggccgctgtcatcacagcgacagtggccacttcccctgcgtgtcccaattatacagtt
gaggattactacaacttgacccagaagcttatctcgaaagattggcgtccaaaggattat
gccgtggtgactctgggactgattgtgagctgcttcatcattgtgactaacatcctggtc
atggctgccatctttatgaaccgacgcttccattaccccatctactacctgctggggaac
ctggcggcggccgacctgttcgccgggatctcctacatgcacctgatgttccacactggg
ccctggactgctaaactcactgtgtaccagtggttcctcagacagggtctgattgatacg
agtctaactgcatcggtcatcaacctgatggccatcgctttagaaagacaccagaccatc
ttcaccatgcagctccacagtaagatgaccaacacgcgggtggtcctgctgattctgggc
atctggacagttgctgtgctcatgggtctgatccccagcatgggctggaactgcctctgc
gacactggtaactgctccaagatggcacccatgtacagccgcacctacttggtgttctgg
gctgtgctcaacctgctgtccttcagtgtcatggtgctggtctatacccgcatcttcatc
tacgtccggcacaagagccagcgcatgagccaacatacggtgcagaacaaacacaaagag
accgtggagaacctgatgaggaccatctttgttattctggggtgttttgtggtgtgctgg
actccgggtctggtgctgctgctgctggacggtgtgaaatgtaattgcggcgtgctcact
gtagagaagttcgtcatgatcctggcagagttaaattcaatgatgaaccccatcatctac
tcgtaccgtgaccaggacatgcggaacacatttaagcgcatcctgtgctggctgtgtttc
cggcgaggacagatgggccagcatgctgatgtccacttcaacacgctcacccaagaggtg
aacaggaataaagatgcaggtgaaaaccccacactgctgcttcaagactcaaggaaaatg
aaaaactcgactaaaacccaactactgaaagctcaaaaaccccccaagagtgtgcaaaac
tcctaa

DBGET integrated database retrieval system