KEGG   Ictalurus punctatus (channel catfish): 108261058Help
Entry
108261058         CDS       T04658                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu03030  DNA replication
ipu03410  Base excision repair
ipu03420  Nucleotide excision repair
ipu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108261058 (lig1)
   03410 Base excision repair
    108261058 (lig1)
   03420 Nucleotide excision repair
    108261058 (lig1)
   03430 Mismatch repair
    108261058 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ipu03032]
    108261058 (lig1)
   03400 DNA repair and recombination proteins [BR:ipu03400]
    108261058 (lig1)
Enzymes [BR:ipu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108261058 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     108261058 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108261058 (lig1)
DNA replication proteins [BR:ipu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108261058 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108261058 (lig1)
DNA repair and recombination proteins [BR:ipu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108261058 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     108261058 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     108261058 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 108261058
NCBI-ProteinID: XP_017317369
UniProt: A0A2D0QGB3
LinkDB All DBs
Position
Un
AA seq 946 aa AA seqDB search
MQRSISSFFQPMKCKEKDGMPKEKSESVKSPLKPQNIDQECDSPMKMSKWSRAIIDSDDE
EQQMVKEEVSKQNGRQTAILGKEKVGLVKDTVSPLSPKPLVTQTTSAVSVTYGIPETTVT
PSSTSPSSIPKRKTARKQFPKRKLDSRSDGEREKEVEGNKTEGGKERKRAKIEESSEKME
NGEEAMEVEQKNRNTVEKELLKAKDEGNMNVTNEKYEVNGKNKEMKKVTKEEKCSPERVM
KRKKEAEEEKREGSAKKKSINCFFAPRKAAVNLEKSEEKSDVEKKDGANAAADTASEEKE
KKGEKDLEPSNQSQYDPSKAHYHPIDDACWKKRQRLRNIETLSNLLRSVILLTPDDLLCC
VYLCLNQLGPSYQGLELGIGETVLMKAVAQATGRQLDKIKTEAQEKGDLGLVAESSRSNQ
RMMFAPANLTAMGVFSKLKEIGNMSGNSAMSKKIDIIKGLFVACRFSEARYIVRSLAGKL
RIGLAEQSVLAALSQAVCLSPPGQDFPPAVIDAGKGMSAESKRAWLEKKGLILKQTYCEM
PNYDAIIPVMLKLGIDELPNHCKLTPGVPLRPMLAHPTKGVGEVMKRFDETAFTCEYKYD
GERAQIHILYSGEVRIFSRNQEDNTSKYPDIISRMPQVKKESVRSFVLDSEVVAWDREKK
QIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVREPLSKRRALLRQSFTEKE
GEFVFARSLDSDNTETIAEFLEQSIRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYL
EGVGDTVDLCVIGAYLGKGKRAGSYGGFLLGCYDDENEEFQSVCKIGTGFKDEDLEQHYN
FLKEHVLPKPRPYYRVDQSAEPDVWLDAAQVWEVKCADLSLSPVYKAAMGLVDPDKGISL
RFPRFLRIRDDKKPEDATTGAQIADLYRKQQQIQNQGDKADLEDYY
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatatcgtccttctttcagccaatgaagtgtaaggagaaggatggcatg
cccaaggagaaatctgagtcagttaaaagccccctcaagcctcagaacattgatcaggaa
tgtgattcaccaatgaagatgagtaagtggagccgagcaatcatagacagtgatgatgaa
gagcagcagatggtaaaagaagaggtttccaaacaaaatggaaggcaaacagccatacta
ggcaaagagaaggttggtcttgttaaggatacagtcagtccactctcaccaaagcccctt
gttacccagacaacctctgctgtttcagtaacttatggcatccctgaaacaactgttacc
ccaagttccacttcaccttccagcatcccaaaacgcaagactgcccgtaagcagtttccc
aagaggaaattggacagcaggagtgatggagagagagaaaaggaggtggaaggaaacaag
acagagggaggaaaggagcgtaaacgagcaaaaatagaagaatcttctgaaaagatggag
aatggtgaagaggctatggaggtggagcaaaagaacagaaatacagtggagaaagaacta
ctgaaagcaaaggatgagggaaacatgaatgtgactaatgagaagtatgaagtgaatggg
aagaataaagaaatgaaaaaagtaacaaaggaggaaaaatgcagtcctgaaagagttatg
aagagaaagaaggaagcagaggaggaaaagagagagggatctgctaagaaaaaatccatc
aactgtttctttgcacccagaaaagctgcagtgaaccttgaaaaatcagaagagaaaagt
gatgtagagaagaaggatggtgcgaatgctgcagctgatactgcttctgaggagaaagaa
aagaagggtgagaaggatctggaaccttcaaaccagagccaatatgatccatctaaagct
cactaccatcccattgatgatgcttgctggaagaagaggcagaggttgagaaacattgag
actctgtccaaccttctgcggtctgttatcctactcactccagatgacctcttgtgctgt
gtgtacctgtgtctgaatcagcttggcccctcctaccaggggctagagctaggcataggg
gaaacagtactgatgaaggctgttgcccaggcaactgggcgtcagctggacaaaatcaag
actgaggcccaggaaaaaggtgacctgggattagtagccgagagttcccgtagtaaccag
agaatgatgtttgcaccagcgaatctgactgcaatgggtgtgttcagcaaactcaaggag
attggcaacatgagtggaaactccgcaatgagtaagaaaattgacatcattaagggtctg
tttgtggcttgtcgtttctcagaggccagatacattgtacggtcactggcaggcaaactg
aggattggattggctgagcagagtgttttagcagctcttagtcaagctgtatgtctgagt
ccaccaggccaagatttcccaccagctgtgattgatgcaggaaaggggatgagtgcagag
agcaagagagcatggcttgagaaaaaaggactcattcttaagcagacttactgtgaaatg
ccgaattacgatgccataatccccgtcatgttgaagttgggcatagatgaactgcctaat
cactgcaaacttactccaggtgtgccactgcgccccatgctggcccacccaactaaagga
gtaggggaggtgatgaaaagatttgatgaaactgctttcacctgtgaatacaagtatgat
ggggagagagcacagattcacattctttatagtggtgaggttcgtatcttcagccgaaac
caagaggataacaccagcaagtaccctgacatcatttcacggatgccacaggtaaagaag
gaatctgtgcgtagctttgtgttggactcggaggtggttgcatgggacagagagaaaaag
cagattcagccgtttcaagttctgaccacacgcaaaaggaaggatgtggatgcatctgag
attaaggtgcaggtttgtgtgtatgcctttgacctgctgtacttaaatggagagtctctg
gtacgggagccattgagtaagcggcgagctttgttgaggcagagtttcacggagaaggag
ggagaatttgtctttgctcgttcgcttgactctgataacactgaaactatagcggagttc
ctggagcagtccatacgagactcttgcgaaggcttgatggtgaagaccttggagaaagat
gccacttacgaaattgccaaacgctctcataactggcttaagcttaagaaggattatctg
gaaggtgtcggggacacagtggatctgtgtgtgattggtgcatatctagggaagggcaag
agagccggtagctatgggggtttcctgcttggctgctatgatgatgagaatgaggagttt
cagtctgtctgtaagataggtacaggtttcaaagatgaagatctggagcagcattacaat
ttcttaaaggagcacgtccttcctaagcctcgcccctactacagagtggaccagtcagca
gagccagatgtttggctggatgctgcgcaagtgtgggaagtgaaatgtgctgatttgtca
ttgtctccggtttacaaggcagcaatgggattggtggacccagataaagggatttccctt
cgctttcctcgattccttcgcatcagagatgacaagaaaccagaggatgctactacagga
gcgcagatagctgatctctacagaaagcagcagcagattcagaatcaaggagataaggct
gatctagaggattactactga

DBGET integrated database retrieval system