KEGG   Ictalurus punctatus (channel catfish): 108271731
Entry
108271731         CDS       T04658                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108271731
   04012 ErbB signaling pathway
    108271731
SSDB
Motif
Pfam: Laminin_EGF EGF_2 EGF
Other DBs
NCBI-GeneID: 108271731
NCBI-ProteinID: XP_017334931
UniProt: A0A2D0RXM0
LinkDB
Position
11
AA seq 189 aa
MYRAFWDTIFLLSGYLFTYSQVQQNATSAATTMAMTPTTTATITATITATNTTAVSSTTV
RRKFIAAAVHSHFADCPDSHSHFCIHGTCRFLILEETQACVCHPGFIGVRCEYADLLAVV
ATNQRQHTLATILMLGILGSVLLVLLCTIINCWWRRGRWRQGPLLSCLSKKPNGIVKSGT
SCCHTETVV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtatcgagctttttgggatacgatatttctccttagtggctatttatttacatacagt
caagtgcagcaaaatgctacgtcagcagcaacaaccatggcaatgactcccaccacaacc
gccactataactgccactataactgccaccaacaccacagcagtgtcaagtactactgtt
agaagaaagttcatagcagcagcagtccactctcactttgctgactgtcctgactcccac
agccatttctgcatccatggaacatgccgctttctcatcctggaggagacgcaagcgtgt
gtgtgccacccaggcttcataggtgtgcgttgtgagtatgcagacctgctggcagtggta
gcaaccaaccaaaggcagcatacattggccactatattgatgctgggcatattgggcagt
gtcctgcttgtactgctttgcaccataataaattgttggtggaggcggggcagatggagg
caaggacctctgctttcctgtttgtcaaaaaaaccaaatggcatcgtaaaaagtgggaca
tcctgctgtcacacagagacagtggtttga

DBGET integrated database retrieval system