KEGG   Ictalurus punctatus (channel catfish): 108278801
Entry
108278801         CDS       T04658                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108278801 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108278801 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    108278801 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ipu00536]
    108278801 (fgf1)
Cytokines and growth factors [BR:ipu04052]
 Growth factors
  Growth factors (RTK binding)
   108278801 (fgf1)
Glycosaminoglycan binding proteins [BR:ipu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108278801 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108278801
NCBI-ProteinID: XP_017347888
UniProt: W5UEP6
LinkDB
Position
18
AA seq 154 aa
MTEGLVTVLGPSPSPFDLEQPSYDALKRLYCRNGGQFLRVLPGGAVDGIRQENDAYTVLK
VKAVSTGVVIIRGHEAGRYLAMDRSGKLYGTSLLNDECYFTEKMEENHYNTYSSHRHREH
GVWYVGIKKNGQMKRGPNTHRGQNAVYFLPIPAQ
NT seq 465 nt   +upstreamnt  +downstreamnt
atgacggagggtctcgtcacggtcctcggaccgtcgccatcgccgtttgatctcgagcag
ccgagttacgacgctttaaagcggctgtactgcaggaacggagggcagtttttacgcgtg
ttacccggcggagctgtggacggaatccggcaagagaacgacgcttacactgtgctaaag
gtgaaagcagtgagcacaggtgtggtgatcatcagaggtcacgaggcgggacgttacctg
gccatggacagaagcggaaagctttatggcacttccttgctgaatgacgagtgctatttc
acggagaagatggaggagaaccactacaacacgtacagttcacacagacatcgggagcac
ggggtctggtacgtgggcatcaagaaaaacggccagatgaaaagaggtcctaacacccac
agaggccagaatgcggtctacttcctgcccattcctgcacagtga

DBGET integrated database retrieval system