KEGG   Ictalurus punctatus (channel catfish): 108279303Help
Entry
108279303         CDS       T04658                                 

Gene name
pcsk1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108279303 (pcsk1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ipu03110]
    108279303 (pcsk1)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     108279303 (pcsk1)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S8: subtilisin family
   108279303 (pcsk1)
Chaperones and folding catalysts [BR:ipu03110]
 Intramolecular chaperones
  Subtilisin family
   108279303 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 108279303
NCBI-ProteinID: XP_017348931
UniProt: A0A2D0T2A7
LinkDB All DBs
Position
18
AA seq 769 aa AA seqDB search
MGVRCRASVAVMMLRATLAVLLCAVCARSQRQYLNEWAVEVPGGLHAARTIADELGYELV
RQIGALENHYLFKHHYHPSRTKRSAYHITKRLSEDDRVSWAEQQYEMKRSKRAPLGGECK
DCSVDKLFDDPMWNQQWYLQDTRTSSSLPKLDLHVIPVWKKGITGKGIVITVLDDGLEWN
HTDIYPNYDPDASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
KGRGGKGSIFVWASGNGGRQGDNCDCDGYTDSIFTVSISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHVPEKKQCIVRDDT
FQPRPLKAAGEISIEIPTKACTGQTNAIFSLEHVQVEASIEYTRRGDLHITLTSPSGTTT
VLLAERERDTSTNGFRNWAFMSVHTWGENPSGTWTLKITDTSGRMENEGQILSWKLILHG
TSEKPEHMKKPRVYTSYNAVQNDRRGVEHMEDMLEEAALSPNKPEKPLTPAKVTSSTPDT
ASGPEEKPALSQSSSSPSLALLRLLQSAFNRQTPAMYPHSVASFGRAETRDRIPKKKLLE
AMEWLKQDTVPENNLYNDYSDNFYRAQAYRHRDDRLMQALFDMLEGEQQ
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgagatgtcgggcttcggtggcggtgatgatgctgcgcgcgactctggcggtt
cttctgtgcgctgtgtgcgcgcgctcccagcgacaatacctgaacgagtgggccgtggag
gtaccggggggtctacacgctgcccggaccatcgccgacgagctcggttacgagttagtg
cgacagattggggccctagagaaccattatttattcaaacatcactatcatcctagcagg
accaaaagaagtgcatatcacattaccaaaaggctgtcagaagatgacagggtgtcttgg
gcagagcagcagtatgaaatgaaacggagcaagcgtgctccactggggggagaatgtaaa
gactgttctgtggacaaactttttgatgaccccatgtggaaccagcagtggtacttgcaa
gacacacggacatcgtcgtcgctgccgaagctggaccttcacgtgatccctgtgtggaag
aaaggcatcactggtaaaggcattgtcatcaccgtgctggatgacggtctggaatggaac
cacaccgacatctacccgaattacgatcctgatgccagttatgatttcaatgacaacgat
cctgatcctttccccagatacgactccaccaatgagaacaaacacggaacaaggtgtgca
ggtgaaatagcaatgcaagcagacaacaacaaatgtggagtcggagtggcgtacaactca
aaggtcggaggaatccgaatgttggacggaattgtgaccgatgccatcgaggcgagctct
atagggtttaaccctgaccacgttgacatctatagtgccagctgggggccgaacgacgat
ggaaaaacagtagaggggccaggtcgtctggcacagaaagccttcgagtatggcatccag
aagggccgtggtggaaagggctccatctttgtttgggcgtcaggtaacggtgggcgtcag
ggtgataactgtgactgtgatgggtatacggacagcatcttcaccgtctccatcagcagc
gcatcacagcagggtctctcgccctggtatgctgagaaatgttcatccaccctcgccacc
gcctacagcagtggagactacactgaccagaggattaccagtgctgatcttcacaatgaa
tgcacagagacacacactggaacatctgcttctgctccactggcagctgggatattcgct
ctggcgttagaacagaatcctgatctaacatggagggacctgcagcacttggtggtgtgg
acgtccgagttcgatcctctagcgaataaccctggctggaagaggaacggcgccggtctt
atggtgaacagccgcttcggattcggcttgctcaacgctaaagctctggtagacctggcc
gatcccaaagtgtggaagcatgtgcctgagaagaaacaatgcattgtgagagatgacacc
ttccagcccaggcctctgaaggcagcaggtgagatcagcattgagatccccactaaagca
tgcactggccagacaaacgctattttctcattagagcacgtgcaggtagaggccagcatt
gagtacaccaggagaggagacctccacatcacgcttacctctccatcaggtactactaca
gtgctcttggctgagagggagagggacacttccactaatggcttcaggaactgggccttc
atgtctgtgcacacctggggagagaacccttccggcacctggaccctgaagatcactgac
acgtcagggcggatggagaatgaggggcagatcctaagctggaagctcattctacacggg
acctctgagaagccggagcacatgaaaaagccgagagtgtacacttcctacaatgctgtg
cagaacgaccgcagaggagtggaacacatggaggacatgctggaggaggccgccctctct
cctaacaaaccagagaagcccctgacaccagctaaagtcacatcttctacacctgacact
gcttctggcccagaagaaaagcctgctttgtcgcagtcttcgtcctcccccagtttagcg
ctgctgcgcctcctccagtcagcttttaacagacagacccctgccatgtatcctcactcc
gtggcttccttcggccgagccgaaactcgagacaggatccctaagaagaagttgctcgaa
gccatggaatggctcaaacaggacacagttcctgagaacaacctgtacaacgactacagc
gacaacttctacagagcacaagcctatcggcacagagacgaccggctgatgcaggctctg
ttcgacatgcttgaaggagagcagcagtga

DBGET integrated database retrieval system