KEGG   Ictalurus punctatus (channel catfish): 108281086Help
Entry
108281086         CDS       T04658                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04012  ErbB signaling pathway
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
ipu04115  p53 signaling pathway
ipu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108281086 (cdkn1a)
   04068 FoxO signaling pathway
    108281086 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108281086 (cdkn1a)
   04115 p53 signaling pathway
    108281086 (cdkn1a)
   04218 Cellular senescence
    108281086 (cdkn1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 108281086
NCBI-ProteinID: XP_017352136
UniProt: A0A2D0TB89
LinkDB All DBs
Position
21
AA seq 175 aa AA seqDB search
MSECVWVHTHTHTNTFSLIQAELMCVMMSSPVLGTLCRGGVEGGVGGSARRCLFGSVDHE
ELQRDYTLLMRAELQDASRRWNFDFIANKPHVGGDIEWVVLPEARVPSLYHDCTVGPVPR
PKGAGPASDLEEDDVPKTPERCEGAEKHTLKRKQTNITDFYQAKRRVVTSRKSGQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtgtgtctgggtacacacacacactcacaccaacaccttcagtctgatccag
gctgagctgatgtgtgtgatgatgtcatcgccggtgttggggacattgtgtagaggtggt
gttgagggtggtgttggtggttctgctcggcggtgtttgttcggttcagtggatcatgag
gagctgcagcgtgactacacactgctgatgagggcggagcttcaggacgcttcacgccgc
tggaactttgacttcattgccaacaaaccgcatgtgggcggcgacatcgagtgggtggtg
cttcctgaggctcgagttccttctctttaccatgattgcacagtagggccagttcctcga
ccaaaaggggcgggaccagcgtctgatctcgaggaggacgacgttcctaaaacacctgag
cgatgtgaaggtgcagagaaacacacactgaagaggaaacagaccaacatcacagatttc
tatcaggccaagaggcgagtcgtcaccagcaggaagtcaggccagtga

DBGET integrated database retrieval system