KEGG   Janibacter limosus: EXU32_15355
Entry
EXU32_15355       CDS       T05853                                 

Definition
(GenBank) 4-oxalocrotonate decarboxylase
  KO
K01617  2-oxo-3-hexenedioate decarboxylase [EC:4.1.1.77]
Organism
jli  Janibacter limosus
Pathway
jli00362  Benzoate degradation
jli00621  Dioxin degradation
jli00622  Xylene degradation
jli01100  Metabolic pathways
jli01120  Microbial metabolism in diverse environments
jli01220  Degradation of aromatic compounds
Module
jli_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:jli00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EXU32_15355
   00622 Xylene degradation
    EXU32_15355
   00621 Dioxin degradation
    EXU32_15355
Enzymes [BR:jli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.77  2-oxo-3-hexenedioate decarboxylase
     EXU32_15355
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-ProteinID: QBF47505
UniProt: A0A4P6MZF0
LinkDB
Position
complement(3197867..3198652)
AA seq 261 aa
MAAWDVESVATELLACEDERRDRVKFTDEWPELDVATGYEIQDLTLQRRLDRGEKLIGIK
LGLTSRAKQQRMGVETPFVAWLTDAMILPAGDPVPQDKLIHPRIEPEIVFVMGERLEGPG
VTAAQAMAAVDQVLGGAEVIDSRYKDFKFAAGDVIADNASSGAFVTGPVSVPPSALDLST
EAVLVEVGGQVVDSATGAAVQGHPGEALALAANDLATRGHAIEAGWIVLTGGMTDAYFAT
PGSSISLHFTTLGSVRIHGGE
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcggcatgggatgtggagtcggtcgcgaccgagctcctggcatgtgaggacgagcgg
cgcgaccgggtgaagttcaccgacgagtggcccgagctggacgtggccaccggctacgag
atccaggacctcaccctgcagcgtcgcctcgaccgcggcgagaagctcatcggcatcaag
ctggggctcacctcgcgggccaagcagcagcgcatgggggtcgagacccccttcgtcgcg
tggctcacggacgcgatgatcctgccggccggcgaccccgtgccgcaggacaagctgatc
cacccgcgcatcgagccggagatcgtcttcgtcatgggcgagcggctcgagggacccggg
gtcaccgccgcgcaggcgatggcggccgtcgaccaggtcctcggcggtgccgaggtcatc
gacagccgctacaaggacttcaagttcgccgccggtgacgtcatcgccgacaacgcgagc
tcgggcgccttcgtcaccggtcccgtgtccgtcccgccgagtgccctggacctgtcgacc
gaggccgtcctcgtcgaggtcggcggtcaggtcgtcgactcggcgaccggtgccgccgtg
cagggccaccccggcgaggcgctcgccctcgctgccaacgacctcgccacccgaggtcac
gccatcgaggccggctggatcgtgctcaccggtgggatgaccgacgcgtacttcgccacc
cccgggtcctccatctcgctgcacttcaccaccctcggctccgtgcggatccacgggggc
gagtga

DBGET integrated database retrieval system