KEGG   Juglans regia (English walnut): 109005683Help
Entry
109005683         CDS       T05245                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 4A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:jre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109005683
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109005683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Big_2
Motif
Other DBs
NCBI-GeneID: 109005683
NCBI-ProteinID: XP_018840259
UniProt: A0A2I4G8M7
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MVKAVAVLGNSNDVKGTIYFTQEADGSTTVTGNVSGLKPGHHGFHVHALGDTTNGCLSTG
PHFNPAGKEHGAPEDENRHAGDLGNITAGADGTAKITITDKQIPLSGPNSIIGRAVVVHE
DVDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggctgttcttggaaacagtaacgatgtcaagggtactatttacttc
acgcaagaagctgatggctctactacagtaactggaaatgtttctggccttaagcctggt
caccatggcttccatgttcatgcacttggggacacgacaaatggttgcttgtcaactgga
ccacatttcaaccctgctggcaaagagcatggtgctccagaggatgagaatcgtcatgct
ggtgatctgggaaatatcactgctggtgcggatggcacagccaaaatcacaataactgac
aagcagattccgctttctggaccaaattccattatcggaagggccgttgttgtccatgaa
gatgtagatgatcttggcaaggggggacatgaacttagcaaaagcactggaaatgctggt
ggccgagtagcttgtggtattattggtctccaaggatga

DBGET integrated database retrieval system