KEGG   Kitasatospora albolonga: B7C62_22515Help
Entry
B7C62_22515       CDS       T05009                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kab  Kitasatospora albolonga
Pathway
kab00564  Glycerophospholipid metabolism
kab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B7C62_22515
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B7C62_22515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ARF77325
UniProt: A0A1V0VIN4
LinkDB All DBs
Position
5068291..5069997
Genome map
AA seq 568 aa AA seqDB search
MRTATLGPAERTAALAAMAERELDVLVVGAGVVGAGTALDAATRGLSTGLVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVREALKERGLLLERLAPHLVKPVPFLYPLQHKGWERLY
AGSGVALYDAMSVSSGHGRGLPVHRHLSRRRALRVAPALKKDALVGALQYYDAQMDDARF
VTELVRTAASYGAQVANRARVTGFLREGERVVGALVQDVEGGTEYEVRAKQVVNATGVWT
DDTQGLIGERGQFHVRASKGIHLVVPKDRIHSSTGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASSADIDYLLQHVNSVLNTPLTRDDVQGVYAGLRPLLAGESDATSKLSR
EHTVAHPVPGLVVVAGGKYTTYRVMAKDAVDEAVHGLDQRVAACVTEDTPLLGAEGYRAL
WNARARIAARTGLHVVRVEHLLNRYGSMTEEILELILADPTLGEPLPAADDYLRAEIVYA
ASHEGARHLDDVLTRRTRISIETFDRGTRSARLCAELMAPVLGWDADRIDREVEHYEKRV
EAERESQRQPDDLTADAARLGAPDIVPG
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacagcgacactgggacccgccgagcgcaccgccgcgctcgccgccatggccgaa
cgcgaactggacgtgctggtcgtgggggcgggagtcgtcggcgcgggcacggcgctggac
gccgccacccgggggctttcgaccgggctggtcgaggcgcgcgactgggcgtccggcaca
tcgagccggtcgagcaagctgatccacggggggctgcgctatctggagatgctcgacttc
gccctggtgcgggaggcgctgaaggagcgcggcctgctgctggagcggctcgccccgcac
ctggtgaagccggtgcccttcctctacccgttgcagcacaaggggtgggagcggctctac
gcgggctccggcgtcgcgctgtacgacgcgatgtcggtctcctccggccacggccggggc
ctccccgtgcaccgccacctctcccgccgccgcgccctgcgggtcgcccccgcgctgaag
aaggacgccctggtcggcgcgttgcagtactacgacgcccagatggacgacgcccgcttc
gtcaccgagctcgtccgcaccgccgcctcctacggggcccaggtcgccaaccgggcccgg
gtgaccggcttcctccgcgagggcgagcgggtcgtgggcgcgctggtccaggacgtggag
ggcggcacggagtacgaggtccgcgccaagcaggtcgtcaacgcgaccggcgtgtggacg
gacgacacccaggggctcatcggggagcgcggacagttccacgtccgggcctccaagggc
atccacctggtcgtccccaaggaccgcatccactcctccaccggcctcatcctgcgcacc
gagaagtccgtgctcttcgtgatcccgtgggggcggcactggatcatcggcaccacggac
accgactgggacctggacaaggcccacccggccgcctccagcgccgatatcgactatctc
ctccagcacgtcaactccgtcctcaacaccccgctgaccagggacgacgtccagggcgtc
tacgccgggctgcgcccgctgctggccggtgagtcggacgccaccagcaagctgtcccgc
gagcacacggtcgcccaccccgtccccgggctcgtcgtcgtggcgggcggcaagtacacg
acgtaccgggtgatggcgaaggacgcggtggacgaggcggtgcacgggctcgaccagcgg
gtggccgcctgtgtcaccgaggacaccccgctgctgggcgccgaagggtaccgggccctg
tggaacgcgcgggccaggatcgccgcccggaccgggctccatgtcgtccgggtggagcat
ctgctcaaccggtacggctcaatgacggaagaaatcctggaactgatcctggccgacccc
accctgggcgaacccctgcccgccgccgacgactacctccgcgccgagatcgtctacgcc
gcctcccacgagggcgcccgccatctggacgacgtcctgacccggcgcacccggatctcc
atcgagaccttcgaccggggcacccgcagcgcccgcctctgcgcggagctgatggccccg
gtgctgggctgggacgcggaccggatcgaccgggaggtcgagcactacgagaagcgggtg
gaggccgaacgcgagtcgcagcggcagcccgacgacctcacggcggacgcggcccggctc
ggcgcgccggacatcgtgccgggctag

DBGET integrated database retrieval system