KEGG   Kosakonia cowanii: BWI95_07120
Entry
BWI95_07120       CDS       T04691                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
kco  Kosakonia cowanii
Pathway
kco00052  Galactose metabolism
kco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BWI95_07120
Enzymes [BR:kco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     BWI95_07120
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C TrkA_N Methyltransf_25 2-Hacid_dh_C UDPG_MGDP_dh_N MTS CoA_binding Pyr_redox_2 Methyltransf_31 ADH_zinc_N_2 Methyltransf_24 Methyltransf_11 PrmA Met_10 ThiF 3HCDH_N
Other DBs
NCBI-ProteinID: APZ04846
LinkDB
Position
1547808..1548851
AA seq 347 aa
MKSVVIHAEGNVCVEDRPEPQLQHEDEVKVRVVSSGLCGSDIPRIFANGAHFYPITLGHE
FSGYVEACGPAVTDLHAGDAVACVPLLPCFDCPACSREYYSLCKRYQFIGSRCDGGNAEY
IVVKRPNLVRLPADLPIEDGAFIEPITVGLHAFHLAAGCKDKNVVIVGAGTIGLLAMQCA
RVLGAKSVTAIDINPDKLALASALGATRTFNSREQSAADILAGLEAECFDQLVLETAGTP
QTVSLAIEIAGPRAQVALVGTLHDELTLTATVFGLILRKELTLIGSWMNYSGPWPGEEWH
TAARLLTEKRLALEPLIAHRGDPESYARAVQALNGKPMQGKILLRLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcatgctgagggcaacgtctgcgttgaagatcgccccgaaccc
cagttgcagcatgaggatgaagtgaaggtgagagtagtcagctccggcctgtgcggctca
gatattccgcgcatcttcgctaacggcgcgcatttctaccccattacccttggacatgag
ttcagcggttatgtcgaagcctgtggcccggcggtcaccgatctgcacgcgggcgacgcc
gtagcctgcgtgccgttgctgccctgctttgactgccctgcctgcagccgggagtactac
tcgctgtgcaaacgctatcagtttatcggctcgcgctgcgacggcggcaatgccgaatac
attgtcgttaagcgacccaacctggttcgcttacctgcggatctgcccattgaagatggg
gcgtttattgaaccgataactgttggcctgcacgcgtttcacctcgccgctggctgtaaa
gataaaaacgtggtgatcgtcggggctggcactatcgggctgctggcaatgcagtgtgca
cgagtcttaggggcgaaaagcgtcaccgccattgatatcaaccctgacaaattagcgctg
gcttctgcgcttggtgccacccgcacctttaacagccgcgagcagagcgcggctgacata
ctcgccgggctggaggcagagtgcttcgatcagcttgtgctggaaacggctggcacacca
caaacggtttcgctggccatcgaaattgccgggccgcgtgcgcaggtggcgctggtaggg
acgctgcatgacgaactcacgcttactgctacggtatttgggctgattttgcgtaaagag
ctgacgcttatcggcagctggatgaactactccggcccctggcctggggaggagtggcat
accgcggcgcgcctgctcacggaaaaacgtctcgcactcgagccgctgattgctcatcgt
ggtgaccccgaaagctacgcgcgcgcggtacaggcgctaaatggcaaaccgatgcaggga
aaaatactgctgcgccttgattaa

DBGET integrated database retrieval system