KEGG   Kangiella koreensis: Kkor_2501
Entry
Kkor_2501         CDS       T00973                                 

Definition
(GenBank) type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
kko  Kangiella koreensis
Brite
KEGG Orthology (KO) [BR:kko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kko02044]
    Kkor_2501
Secretion system [BR:kko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Kkor_2501
SSDB
Motif
Pfam: T6SS_VasE HrcA
Other DBs
NCBI-ProteinID: ACV27910
UniProt: C7R9P1
LinkDB
Position
complement(2705850..2707193)
AA seq 447 aa
MSNKVVWSQGLFLTPEHFQQQDQYNEYQLKRMIKSLSRHGYGLKKLILNKEQLLQGKLGV
KEAEGLLKDGTYFSIPERNLLPSLLDLSEVDNINDKRIMLAIAENVDNKKLVAQEINSES
SKRYRKELKKVSSINVGEESEIAIEVAEENYQLMVEGKSQDGYECLPIARIKEKKQDGSI
ELDESFVPVVLDLHASGILSSRMNNLLSLLEHRREKLAAKVMGVDNSTASSIHNYLILQL
LNKYLAELQQLLEQEYSIPYELYLGLINLEAELATFYSSARKPQKQMAYSQNMIDECFSQ
VEASIKQYLSHVLDESAHEIVLEDKGYGVRVAHIDQVELFKQASFVIAVKAEIATRELKE
QLPRQIKIGSLSNIRQLVNAQLPGINLSEMSVAPREVPVKKDYSYFAIDSRSPLWNENST
SRSIAFHISGDFPGLDVELWAIKNELS
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagcaacaaggtggtttggtcacaaggcttatttttaacccctgagcactttcaacaa
caagaccaatacaatgaataccagctaaagaggatgatcaagtcattgtccaggcatggc
tatggattaaagaagctgatactcaataaagagcaactgttacaaggcaagcttggcgta
aaggaagccgaaggattgctgaaggacggtacttatttttcgattcctgagaggaacctc
ttgccgtcactgttagacctgtcggaagtggacaatatcaatgacaagcgaatcatgctg
gccattgccgaaaatgtcgataataagaaactggtagctcaggaaattaacagcgaatcc
agtaagcgatatcgaaaagaactcaaaaaagttagcagtatcaatgtaggtgaagagagc
gagattgccattgaagtagctgaagaaaattatcagttgatggtagagggtaaaagtcag
gatggttatgaatgtctgccaatcgctagaataaaagagaaaaagcaggacggcagcatt
gagcttgatgagtccttcgtacctgtagtgctggaccttcatgctagcggtattctcagc
agcagaatgaataatttattgagtctgcttgaacaccgtagagaaaaattagccgcaaaa
gtcatgggtgtcgataattcgacagcgagcagcatccataactacctcatattgcaattg
ctcaataaatatttagcagagttacaacagttgctggagcaggagtatagcattccttat
gagctgtatttgggcttgattaatctcgaagcggagttggctaccttctacagctctgcg
cgtaaaccacaaaagcaaatggcctactcgcaaaacatgatcgatgaatgtttcagtcag
gtcgaggcgagcattaagcaatacttaagccatgtgttagatgaaagtgctcatgaaata
gtgttggaagataagggttatggcgtaagagttgctcatattgatcaggtagaactgttt
aagcaggccagttttgtgattgctgtaaaagcagaaatagcgacaagagaattaaaagag
caattacccagacaaataaaaattggcagtctgagcaacatcaggcaattggtcaatgcg
caattaccagggataaacctgtctgaaatgtcggttgcgccaagagaagtaccggttaaa
aaagattacagttattttgctattgatagccgttctccgctgtggaatgaaaatagtact
tccagaagtattgcattccatatttctggagacttcccaggtctcgatgttgagttatgg
gcaatcaaaaatgaactgtcctaa

DBGET integrated database retrieval system