KEGG   Kryptolebias marmoratus (mangrove rivulus): 108232929Help
Entry
108232929         CDS       T05608                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr03030  DNA replication
kmr03410  Base excision repair
kmr03420  Nucleotide excision repair
kmr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108232929 (lig1)
   03410 Base excision repair
    108232929 (lig1)
   03420 Nucleotide excision repair
    108232929 (lig1)
   03430 Mismatch repair
    108232929 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:kmr03032]
    108232929 (lig1)
   03400 DNA repair and recombination proteins [BR:kmr03400]
    108232929 (lig1)
Enzymes [BR:kmr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108232929 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     108232929 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108232929 (lig1)
DNA replication proteins [BR:kmr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108232929 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108232929 (lig1)
DNA repair and recombination proteins [BR:kmr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108232929 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     108232929 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     108232929 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 108232929
NCBI-ProteinID: XP_017266559
LinkDB All DBs
Position
Unknown
AA seq 1017 aa AA seqDB search
MQRSIASFFQPKSKDKDNQKKATSETVKNVSVHVSRPVKSPLKVQNGVQEADSPIKKVAK
RSRQILDSDEDEAPAVKEQAATEGQGDKEAKTEKKDDEFKAVPTPLSPPPAPATPVTPAT
PATPASSASPGTPSTPSSPSSISPTGITKRKTARKMFPKRKLDESGSGKEETEVTEEQGQ
QNKRPRVESCVSSAGNTGEPMEEGAEEERVEKAATEANRPDEEVENKKKEEAEKAKKEEE
QVEKKSCDEKEKKAEGAAKKNEVKEKTDDEKGPAVANEKVGEKDTPDTGSPKSQTVEKKQ
KEAKEQKDKEPAKKTPISSFFAPRKAAVKTDKTETNEGEKKTNAEKKNSGEERKDEKGDS
TSGQTDYDPSRPNYHPMEHACWKRGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLFRSV
LLLSPDDLLCCVYLCLNQLGPAYLGMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDL
GLVAESSRSNQRMMFQPASLTAGGVFRKLKEIASMSGNSAMNKKIDIIKGLFVACRFSEA
RYIVRSLAGKLRIGLAEQSVLSALSQAVCLTPPGQAFPPAVIDAGKGLSAESRRARIEEK
SLILKQTYCEMPNYDVIVPVLLKEGIEQLPHHCKLTPGVPLRPMLAHPTKGVGEVMKKFD
EAAFTCEYKYDGERAQIHILESGEVRIFSRNQEDNTSKYPDIISRIPKTKKDSVVSCVLD
TEAVAWDREKKQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRR
ELLKESFSEVEGEFQFARSIDANNTDAIAEFLEQSVRESCEGLMVKTLEKDATYEIAKRS
HNWLKLKKDYLDGVGDTVDLCVIGAYLGKGKRTGTYGGFLLACYDEENEEFQSVCKIGTG
FKDEDLEQHYKFLKEHILPKPRAYYRVDQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAM
GMVDPEKGISLRFPRFLRIRDDKKPEDATTGAQIADLYKKQQQIQNQGDKADPEDYY
NT seq 3054 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcattgcatcattttttcagcccaagagcaaagataaggacaatcagaag
aaagcaacaagtgaaacagtgaagaacgtgtctgtgcatgtttccaggcctgtcaagagc
cccctgaaggtgcagaatggtgttcaggaagcggattcacccatcaagaaggttgccaaa
cgcagccgtcaaatcctggacagcgatgaagacgaggctccggctgttaaagaacaagct
gccaccgagggacagggagacaaagaagctaaaacagagaagaaggacgatgaattcaag
gccgtccccaccccgctgtctcctccaccagccccagctacacccgtaacccccgccact
ccagctactccggcctcttcggcgtccccaggcacccccagcacccccagttcccccagt
tccatctccccgacggggatcaccaaacgcaagactgcgaggaagatgttccccaagagg
aagctggatgagagcgggagcgggaaagaggagacggaggtcacggaggagcagggtcag
caaaacaaacgacctcgtgtggagagctgtgtcagcagcgcagggaacaccggcgaaccc
atggaggagggagcagaggaagaaagggttgaaaaggcagcgactgaggctaacagacca
gatgaggaggtggagaacaaaaagaaagaagaagcagagaaggccaagaaggaggaggag
caggtagaaaaaaagagctgtgatgagaaagaaaagaaagctgagggggcggcaaagaaa
aatgaagtgaaggagaagactgatgatgagaaagggcccgccgttgccaacgagaaggtg
ggtgaaaaggacacgccagacacggggagcccgaaaagtcaaacggttgaaaaaaagcag
aaggaggcgaaggagcagaaagataaggagccggccaagaaaaccccaatcagcagtttc
tttgctcccaggaaagcagcagtgaagacggacaaaacggagacgaatgaaggagagaag
aagacgaatgcagagaagaagaactcaggggaggagcgtaaagacgagaaaggcgactcg
acttcaggacagacggactacgatccttccagaccgaactaccatccgatggagcacgcc
tgctggaaacgaggccaaaaagtgccgtacttggccgtggctcgcacctttgagaagatt
gaagaggactctggcaggctgaggaacatcgagacgttgtcaaacctgtttcgctccgtg
ctgctgctctctccagatgacctgctgtgctgcgtgtacctgtgtttgaaccagctcggc
cctgcctacctggggatggagctcggcgtcggggaaacggtgctgatgaaagccgtcgct
caagcaaccgggcgacagttggacaaaattaaagcggaggcgcaggagaagggagacttg
ggcctcgtggccgagagctcccgtagcaaccagcgcatgatgttccagccggccagcctg
actgcagggggcgtgttcaggaaattgaaggaaattgccagcatgagtgggaactcggcc
atgaataagaaaatcgacatcatcaaaggcctctttgtggcatgccgcttttcagaggcc
cgctacatagtcaggtccctggctgggaagctgaggattggcctcgctgagcagagcgtg
ctttctgctctgagccaagctgtctgtttgaccccacctggacaagcttttccccctgct
gtgatcgacgcagggaagggtctgagcgccgagagcaggcgggcccggatcgaagagaag
agtctgattctgaagcaaacttactgcgagatgcccaattatgacgtcatcgttcccgtt
ctgctgaaagaaggcatcgagcagcttccccatcactgcaagctgactccaggtgtgccg
ctgagacccatgttggcgcaccccaccaagggtgttggcgaggtgatgaagaagtttgat
gaggcggctttcacctgcgagtacaaatacgacggcgagcgtgcacagattcacattctg
gagagcggtgaagttcggatattcagccgcaaccaggaagacaacaccagcaaatacccc
gatatcatctctcgcattcccaagacaaagaaagactctgtggtttcttgcgttctggac
accgaggcagttgcctgggatcgcgagaagaaacagatccagcccttccaggtcctcacc
acccgtaaaagaaaggatgtggatgcctccgagatcaaagtccaagtgtgtgtgtatgcc
tttgacctcctctatctcaacggagagtctctggtgcgacagccgctgtgtcggcgtcgg
gagctgctgaaagagagcttctcagaggtggagggagagtttcagtttgctcgttccatc
gacgccaacaacactgacgccatcgcagagtttctggagcagtctgtccgagaatcgtgc
gaaggcctgatggtgaagactctggagaaggatgcgacctacgagattgccaagcgctct
cataattggctcaagctgaagaaggattacctggacggagtcggtgacacggtcgatctt
tgtgtgatcggcgcctatttggggaaaggaaaaaggacgggcacctacggaggcttcctg
ttggcctgctacgatgaagaaaacgaggagtttcagtccgtctgcaagatcgggacaggc
tttaaggatgaagatctggagcagcattacaagtttttaaaggagcacatcctgcccaaa
ccgcgcgcctactaccgcgtggaccagtcggcggagcccgacgtgtggctggacgccgtg
caggtttgggaggtgaagtgtgccgacctctcgctgtcgcccgtctacaaggccgccatg
ggaatggtggatccggagaagggcatttctctcaggttccctcgattccttcggatcaga
gacgacaagaagcccgaggacgccacaaccggagctcagatcgccgatttgtacaagaag
cagcagcagattcagaatcaaggagacaaagctgacccagaggactactactga

DBGET integrated database retrieval system