Kluyveromyces marxianus: KLMA_30122 Help Entry KLMA_30122        CDS       T05269                                  Name (RefSeq) DASH complex subunit HSK3   KO K11571   DASH complex subunit HSK3 Organism kmx  Kluyveromyces marxianus Brite KEGG Orthology (KO) [BR:kmx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:kmx03036]     KLMA_30122 Chromosome and associated proteins [BR:kmx03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     DASH complex      KLMA_30122 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DASH_Hsk3 FTA4 TSKS ssDNA_TraI_N Motif Other DBs NCBI-GeneID:  34715412 NCBI-ProteinID:  XP_022675267 LinkDB All DBs Position 3:270055..270249 Genome browser AA seq 64 aa AA seqDB search MDTKQRQYARLAMHLKQLRENLDETCAQVETMAQQSKMITKLGANQAASFIGSSRVFENE MLKK NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atggacaccaagcagcggcagtatgcgcgtctggcgatgcacctaaagcagttgcgggaa aacctcgatgagacgtgtgctcaggtcgagacgatggcccaacaaagcaaaatgatcacc aaactcggagccaaccaagcagcgtcttttattgggagcagccgcgtgtttgagaacgaa atgttgaagaagtag

DBGET integrated database retrieval system