KEGG   Klebsiella pneumoniae 342: KPK_0404Help
Entry
KPK_0404          CDS       T00772                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
kpe  Klebsiella pneumoniae 342
Pathway
kpe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KPK_0404 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kpe03011]
    KPK_0404 (rplV)
Ribosome [BR:kpe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KPK_0404 (rplV)
  Bacteria
    KPK_0404 (rplV)
  Archaea
    KPK_0404 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACI09926
UniProt: B5XN99
LinkDB All DBs
Position
433196..433528
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgcctcgta
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaac
aaaaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system