KEGG   Klebsiella variicola 342: KPK_5003
Entry
KPK_5003          CDS       T00772                                 

Gene name
pepA
Definition
(GenBank) leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
kpe  Klebsiella variicola 342
Pathway
kpe00480  Glutathione metabolism
kpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPK_5003 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kpe01002]
    KPK_5003 (pepA)
Enzymes [BR:kpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     KPK_5003 (pepA)
Peptidases and inhibitors [BR:kpe01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   KPK_5003 (pepA)
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Other DBs
NCBI-ProteinID: ACI09530
UniProt: B5Y2T8
LinkDB
Position
5051462..5052973
AA seq 503 aa
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQTL
LLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKGR
NNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPTRRELTSGERAIQHGLAI
AAGIKAAKDLGNMPPNICNAAYLASQARQLADTYSKNVITRVIGEQQMRELGMNSYLAVG
NGSQNESLMSVIEYKGNPSEDARPIVLVGKGLTFDSGGISIKPAEGMDEMKYDMCGAAAV
YGVMRMVAELQLPLNVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVLC
DVLTYVERFEPEAVIDVATLTGACVIALGHHITGLMSNHNPLAHELIGASELAGDRAWRL
PLADEFQDQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSGKAKG
ATGRPVALLSQFLLNRAGFNGEE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggagttcagtgtaaaaagcggtagcccggagaagcaacggagcgcctgtatcgtggtc
ggcgtctttgaaccacgtcgcctctcccccatcgccgaacaactcgataaaatcagcgac
ggctacatcagcgccctgctgcgtcgcggcgagctggaaggcaaacctggccagacgtta
ttgctgcaccatgtgccaaacattctgtctgagcgcattctgctgattggctgcggcaaa
gagcgcgagctggatgaacgtcagtataagcaggtcatccagaaaaccatcaataccctg
aatgataccggttcaatggaagccgtctgcttcctgaccgagctgcacgtcaagggccgc
aacaactactggaaagttcgccaggccgttgaaaccgccaaagagacgctgtacagcttc
gatcagttgaagaccaacaaaagcgagccgcgtcgcccgctgcgtaaaatggtctttaac
gtgccgacccgtcgcgagctgaccagcggagaacgcgccattcagcatggcctggcgatc
gccgccggcatcaaagcggcgaaagatcttggcaacatgccgccgaacatctgtaacgcc
gcctatctggcttcccaggcgcgtcagctggccgatacctacagcaagaacgtcattacc
cgcgtgatcggcgaacagcagatgcgcgagctggggatgaactcctatctcgccgtcggc
aacggctcgcagaacgagtcgctgatgtcggtcatcgagtataaaggcaacccgtctgag
gacgcgcgccctatcgtgctggtcggtaaaggcctgaccttcgactccggcggcatctcc
atcaagcctgccgaaggcatggacgagatgaagtacgacatgtgcggcgccgcggcggtg
tacggcgtgatgcggatggttgccgagctgcagctgccgctgaacgtcatcggcgtgctg
gcgggctgtgaaaacatgcctggcggtcgcgcctatcgtccgggtgacgtcctgaccacc
atgtccggccagacggtggaagtcctgaacaccgacgccgaaggccgcctggtgctgtgc
gacgtcctgacctacgttgagcgtttcgaaccggaagcggttatcgacgtcgcgacgctg
accggcgcctgcgtgattgccctcggccatcacatcaccggcctgatgtcgaaccataac
ccgctggctcatgagctgatcggcgcctccgaactggcgggcgaccgcgcctggcgtctg
ccgctggccgacgagttccaggatcagctggagtccaattttgccgatatggcgaacatc
ggcggtcgtcctggcggcgcaattaccgccggctgcttcctgtcgcgctttacccgtaag
tacaactgggcgcacctcgacatcgccggtaccgcctggcgttccggtaaggccaaaggc
gccaccggtcgtccggtcgccctgctgtcgcagttcctgctcaatcgtgcgggttttaac
ggcgaagagtga

DBGET integrated database retrieval system