KEGG   Kibdelosporangium phytohabitans: AOZ06_32985Help
Entry
AOZ06_32985       CDS       T04088                                 

Definition
(GenBank) hydrolase TatD
  KO
K07051  uncharacterized protein
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AOZ06_32985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase Amidohydro_2 PTE
Motif
Other DBs
NCBI-ProteinID: ALG11062
UniProt: A0A0N9I5W6
LinkDB All DBs
Position
complement(7331282..7332145)
Genome map
AA seq 287 aa AA seqDB search
MRIFDPHIHMTSRTTDDYEAMFAAGVRAIVEPAFWLGQPRTGVDSFKDYFDALIGWERFR
AAQFGIRHHCTIALNPKEANDPRCTPVLDILPRYLAKDGVVAVGEVGYDSMTPEEDDAFA
RQLAMAVEHELPALVHTPHRDKLAGTHRTLDVVKESGIAPEFVAVDHLNEVTVKTVKDSG
CWMGFSIYPDTKMDEDRMVAILKEYGTDKVLVNSAADWGRSDPLKTYKTARQMLEAGFTA
ADVDKVLWQNPVDFYGQSGRLVLDELPGFTASAETFAGNSVLRGGRR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcttcgacccgcacatccacatgacctcgcggaccaccgacgactacgaggcg
atgttcgccgccggcgtgcgcgccatcgtcgaaccggccttctggctgggccagccccgc
accggcgtcgactcgttcaaggactacttcgacgcgctgatcgggtgggagcggttccgc
gcggcccagttcggcatccgccaccactgcacgatcgcgttgaacccgaaggaagccaac
gacccccgctgcacgccggtgctggacatcctgccgcgctacctcgccaaggacggcgtg
gtcgcggtcggcgaggtcggctacgactcgatgacgccagaggaggacgacgccttcgcc
cgccagctcgcgatggccgtcgagcacgaactgcccgcgctcgtgcacaccccgcaccgc
gacaagctcgctggtacacatcggacgctggacgtggtcaaggagtccgggatcgcaccg
gagttcgtcgcggtcgaccacctcaacgaggtcacggtcaagaccgtcaaggactccggc
tgctggatggggttctcgatctacccggacaccaagatggacgaggaccggatggtcgcc
atcctcaaggagtacggcaccgacaaggtcctggtgaactccgccgccgactggggccgc
tcggacccgttgaagacgtacaagaccgcgcgccagatgctcgaagcggggttcaccgca
gccgacgtggacaaggtgctctggcagaacccggtcgacttctacggccagagcgggcgg
ctcgtgctcgacgagctgcccgggttcaccgcgtcggcggagacgttcgcgggcaactcg
gtgctgcggggtggccgccgatga

DBGET integrated database retrieval system