KEGG   Kineococcus radiotolerans: Krad_1424Help
Entry
Krad_1424         CDS       T00562                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00250  Alanine, aspartate and glutamate metabolism
kra00280  Valine, leucine and isoleucine degradation
kra00310  Lysine degradation
kra00410  beta-Alanine metabolism
kra00640  Propanoate metabolism
kra00650  Butanoate metabolism
kra01100  Metabolic pathways
kra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Krad_1424
   00650 Butanoate metabolism
    Krad_1424
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Krad_1424
   00280 Valine, leucine and isoleucine degradation
    Krad_1424
   00310 Lysine degradation
    Krad_1424
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Krad_1424
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kra01007]
    Krad_1424
Enzymes [BR:kra01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Krad_1424
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Krad_1424
    2.6.1.48  5-aminovalerate transaminase
     Krad_1424
Amino acid related enzymes [BR:kra01007]
 Aminotransferase (transaminase)
  Class III
   Krad_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ABS02912
UniProt: A6W7X3
LinkDB All DBs
Position
complement(798296..799678)
Genome map
AA seq 460 aa AA seqDB search
MTTLSSPDATSAPAVGGPALPQEIRLRTEVPGPLSRELAARRVAAVSAAVGSSMPFYAAV
AGGGVVVDVDGNSYADLGSGIAVTTVGNADPAVVAAVGEQVGRFTHTCFMITPYDSYVAV
AERLNALTPGDFPKRTALFSTGAEAVENAVKVARAFTGRQAVVVFDHAYHGRTNLTMAMT
AKNMPYKNGFGPFAPEVYRAPLSYPFRDGLDGPTAAARAIATIEKQVGAANLAAVVVEPV
QGEGGFIVPAPGFLPAIAAWARENGVVFVADEVQTGIARTGAVFASHLEGIEPDLVTIAK
GVAGGLPLAAVTGRAEILDAPVVGGLGGTYGGNPAACAAALATLDAVEHEDLPARARQLE
GVLLRRLHALAAVDPRVGDVRGRGAMVAVELVRPGTTEPDAALAKRVAADAARRGVIVLT
CGTDGNVLRFLPPLSIPDALLEEAFDVLDDVFATDRPTAR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctcagcagccccgacgcgacgagcgcccccgcggtgggcggcccggccctg
ccccaggagatccggctgcgcaccgaggtccccgggcccctctcgcgcgagctcgccgcg
cggcgggtggccgccgtctccgccgccgtggggtcctcgatgcccttctacgccgcggtc
gccggcggcggggtcgtcgtcgacgtcgacgggaactcctacgccgacctcggctccggc
atcgccgtgacgaccgtcgggaacgccgaccccgccgtcgtcgccgccgtgggcgagcag
gtcgggcgcttcacccacacctgcttcatgatcaccccctacgactcctacgtcgcggtc
gccgagcgcctcaacgcgctgacccccggcgacttccccaagcgcaccgcgctgttctcc
accggcgccgaggccgtggagaacgccgtcaaggtcgcccgcgccttcaccggccgccag
gccgtcgtcgtcttcgaccacgcctaccacggccgcaccaacctcacgatggccatgacg
gccaagaacatgccgtacaagaacggcttcgggcccttcgcccccgaggtctaccgcgcc
cccctgagctaccccttccgcgacggcctcgacggccccaccgccgccgcccgcgcgatc
gccaccatcgagaagcaggtcggggccgcgaacctcgccgccgtcgtcgtcgagccggtc
cagggcgagggcgggttcatcgtgcccgcccccgggttcctgcccgcgatcgcggcctgg
gcgagggagaacggcgtcgtcttcgtcgccgacgaggtgcagaccggcatcgcccgcacc
ggcgcggtgttcgcctcgcacctggaggggatcgaaccggacctggtgaccatcgccaag
ggcgtcgccggcggtctgccgctggccgcggtcaccggccgcgccgagatcctcgacgcc
cccgtcgtcggcggtctgggcggcacctacggcggcaaccccgccgcctgcgccgccgcc
ctggccaccctcgacgcggtggagcacgaggacctgcccgcccgggcccggcagctggag
ggggtcctcctccgccgcctgcacgccctggccgccgtcgacccccgcgtcggcgacgtc
cgcggacgcggcgcgatggtcgccgtggagctcgtccggcccgggaccaccgaacccgac
gccgcgctggccaagcgggtcgccgccgacgccgcccggcgcggggtcatcgtcctgacc
tgcggcaccgatggcaacgtcctgcgcttcctgcccccgctgagcatccccgacgcgttg
ctggaggaggcgttcgacgtcctcgacgacgtcttcgccaccgaccggcccaccgcgcgc
tga

DBGET integrated database retrieval system