KEGG   Komagataeibacter saccharivorans: CD178_01130
Entry
CD178_01130       CDS       T05634                                 

Gene name
ptsI
Definition
(GenBank) Phosphoenolpyruvate-protein phosphotransferase
  KO
K23993  multiphosphoryl transfer protein [EC:2.7.3.9 2.7.1.202]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CD178_01130 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01130 (ptsI)
Enzymes [BR:ksc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     CD178_01130 (ptsI)
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     CD178_01130 (ptsI)
Transporters [BR:ksc02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Multiphosphoryl transfer protein
    CD178_01130 (ptsI)
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilizers PEP-utilisers_N
Other DBs
NCBI-ProteinID: AXY21923
UniProt: A0A347WAN0
LinkDB
Position
1204752..1206590
AA seq 612 aa
MKTTERRPARRGRPGEIRLEGQPVSPGVAIGYAAIAHEPAPPPVDMARRDCDPAHERTRL
HDAISRSVAQLGRLHDRLALLPEDGQVEIGSLLEVYRRMLGPSRLRRGIEGRLDQGMVAE
AAVMQETEALAGFMLAPPGRVAPEGEDAVAARRRAGEFREIGRRLIRNLSGTPYRSFSAL
PDGAILVAEQLRPADAALIDPSRIAAVVTEEGGSTGHTAILLRALGIPAVLAAHGLLAQL
GRRTRLVVDGTTGQVIVRPSTRTAAAARVDVAAYARERQMLGRLRRLPARLSSGEVVTLQ
ANLEIPAELPMIAQSGAGGIGLLRSEFLFMNAETLPDELHQEAVYLPLIEAMAGDPVTIR
VVDWGSEKNSDALSRAGIGESGDTNPALGVRGIRLLLQHRGLLETQFAAILRAARAGPVR
VMLPLVSSVGELRAARDIYARIGRRLRRKGVEIPDPLPPLGIMIETPAAALMADVLAQEA
EFLAIGTNDLTMYTLAADRAATDVAALYDPFHPAVLQLVRMTADAALRHRRPVSLCGEMA
SDPIAVPLLVGLGIRSFSMHASAVPRVKRAIRALAMDDCRRMACRALEAADGREVSTMLM
DYAAAARQPADE
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaagacgactgaacgccgccccgcgcgtcgggggcggccaggtgaaatccggcttgaa
ggtcagcctgtctctcccggtgttgcgatcggttatgccgcgatcgcgcatgaaccggcc
ccgccgccggtcgatatggcacggcgcgactgcgatccggcccatgaacgcacgcgcctg
catgatgcgatcagccgctccgtcgcccagcttggtcggctgcatgaccgccttgccctt
ctgcccgaggacgggcaggtggaaatcggttccctgctggaagtctaccggcgcatgctt
ggcccttcgcgcctgcgtcgcgggattgagggacgactggatcagggcatggtggccgaa
gccgccgtcatgcaggaaaccgaagcgcttgcgggcttcatgctcgccccgcccggcagg
gtcgccccggaaggggaagacgcggtggcagcaaggcgccgcgcgggggagtttcgggaa
atcgggcgtaggctgatccgaaacctaagcggcacgccctaccgctctttttccgccctg
cccgatggggccattctggttgccgaacagcttcgccccgccgatgccgccctgatcgat
ccgtcgcgtatcgccgccgtggtgacggaagaagggggcagcaccgggcataccgccatc
ctgctgcgcgcgctgggtatcccggcggttctggctgcccatggcctgctggcacagctt
gggcggcggacgcggcttgtggtggatggcacgacggggcaggtcatcgtgcgtccgtcc
acccgcaccgccgctgccgcgcgggtcgatgtcgccgcctatgcgcgcgaacgccagatg
ctgggccgcctgcgcaggcttccggcccggctttccagcggggaggtcgtgaccctgcag
gccaatctggaaatccctgccgaactgcccatgatcgcgcagtccggcgccggggggatc
ggactgctgcgcagcgaattcctgttcatgaatgcggaaaccctgcccgatgaactgcat
caggaagcggtctacctgcccctgatcgaagcgatggccggggacccggtgacgattcgc
gtggtggactggggcagcgaaaaaaacagcgatgccctgtcgcgtgccgggattggcgaa
agcggcgataccaatcccgcccttggcgtccgtggcatccggctgctgcttcagcatcgc
ggcctgctggaaacgcagtttgccgccatcctgcgcgcggcccgtgcgggaccggtgcgg
gtgatgctgccgctggtctcatctgtgggggaattgcgggccgcgcgtgacatctatgcc
cgcatcggacgcaggctgcggcgcaagggggtggagatacccgacccgctgccgcccctg
ggcatcatgatcgaaacgccagccgccgcccttatggcggatgtactggcgcaggaagcg
gaattcctggccatcggtaccaacgacctgaccatgtatacccttgcggcggaccgggcg
gcgacggatgtcgcggcgctgtatgatccgttccatcccgccgtgctgcaactggtgcgc
atgacggcggatgcggccctgcggcatcgcaggccggtttccctgtgtggggaaatggca
tccgatccgatagcggtgcccctgctggtcgggttgggaatacggtccttttccatgcat
gcctccgccgtgccgcgcgtcaaacgtgcgatccgggcgctggccatggatgactgccgc
cgcatggcctgtcgcgcgctggaagcggccgacgggcgcgaggtcagcaccatgctgatg
gattacgccgctgccgcgcgacagcctgcggatgaataa

DBGET integrated database retrieval system