KEGG   Komagataeibacter saccharivorans: CD178_02035
Entry
CD178_02035       CDS       T05634                                 

Gene name
lolD
Definition
(GenBank) Lipoprotein-releasing system ATP-binding protein LolD
  KO
K09810  lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CD178_02035 (lolD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_02035 (lolD)
Enzymes [BR:ksc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     CD178_02035 (lolD)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter
    CD178_02035 (lolD)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_25 AAA_22 SMC_N AAA_29
Other DBs
NCBI-ProteinID: AXY22792
UniProt: A0A347WD49
LinkDB
Position
2160833..2161558
AA seq 241 aa
MNENPNPSTPALRMDAVARRYISGEEVLDVLRGADLTLYPGEIVALVAPSGTGKSTLLHL
AGLLEKPDAGCILLAGQDAGALPDRDRTELRRDRIGFVYQFHHLLAEFSARENVMLPQMI
AGVPRRQARERAEELLAAFGLGHRLEHLPGKLSGGEKQRVAIARALANRPQVLLADEPTG
NLDVHTSDAVFDALLETVRAHGVAALIATHNMDLARRMDRVVTLRDGKIIPLEDTSGETD
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatgagaaccccaatccgtccacacccgcgctgcgcatggacgcggttgctcgccgt
tatatcagcggggaagaagtgctggacgtgctgcgtggcgcggacctgaccctctatccc
ggtgagatcgtggcccttgtggccccgtcgggcacgggcaagtcgaccctgctgcacctt
gcgggcctgctggaaaaacccgatgcgggctgtatcctgctggcaggacaggacgcgggt
gcgctgccggaccgggatcggacggaactgcggcgggaccggatcggtttcgtgtatcag
ttccatcaccttctggcggaattcagcgcgcgggaaaacgtcatgctgccgcagatgatc
gcaggcgttccgcgcaggcaggcacgcgaacgggccgaagaactgctggcggcgttcggg
ctggggcaccgcctggaacatctgcccggcaagctttcgggcggggagaagcagcgcgtg
gccattgcccgtgcccttgccaaccgcccgcaggtgctgctggcggatgaaccgaccggc
aatctggatgtccatacatctgatgcggtattcgacgcactgcttgaaaccgtgcgggcg
catggcgtggcggccctgatcgccacccataacatggaccttgcacggcgcatggaccgc
gttgttaccctgcgtgacgggaagatcatcccgctggaggacacgtcgggcgagacggac
gcctag

DBGET integrated database retrieval system