KEGG   Lingula anatina: 106163703
Entry
106163703         CDS       T04921                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lak  Lingula anatina
Pathway
lak00220  Arginine biosynthesis
lak00330  Arginine and proline metabolism
lak01100  Metabolic pathways
lak04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106163703
   00330 Arginine and proline metabolism
    106163703
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106163703
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106163703
SSDB
Motif
Pfam: NO_synthase Flavodoxin_1 FAD_binding_1 Flavodoxin_5
Other DBs
NCBI-GeneID: 106163703
NCBI-ProteinID: XP_013396821
UniProt: A0A1S3IG29
LinkDB
Position
Unknown
AA seq 655 aa
MLNLKDSEEHLQRKAVVAQAIQDTGTYHIEYDELVFGAKTAWRNASRCSGRIQWKNLQVF
DAREIQTAEEMFRAICRHLTWATNGGNIRSAMTVFPARTNKKKDFRIWNSQFIRYAGYRM
PGGHIIGDPSNLSFTQICERLGWKGKGGHFDVLPLVLSANGELPELFEIPKEIILEVELT
HPRFDWFKELGLKWYAVPVVSNMLFDCGGLEFPAAPFNGWYMGTEIGARNLCDVQRYNIL
EIVGQHMGLDCRSSVNLWKDLALVEVNIAVLHSYQKAGVSIVDHHTVAESFVQFMLQEAK
TRGGCPADWVWIVPPISGSITPVFHQEMVNYTIKPSFDYQEDPPLLLLNQLDKEKNMKNL
VFGIFRAVLLATKLKMKIRKCRPRCLILFASETGKSEQFARRLEATMGRAFNARTVCMED
YPVYNFLQEQLVLVVTSTFGLGSPPLNGETFFRALESFEKNLSNIRFAVFGLGSKAYPRF
CAFAVHIDNLLRNLGGQRMTSLVKADSLSGQEKPFVKWSRQVYNEACALYGLLTFKHADD
IEVTTEWHEERFRYTVVGKEENIIKGLSEIHGYQMQSFNIISSTNLQAKSSGLRTLSVKL
QSTTNKDKLVYQHGDHMLIFPTNNIAMVTAIIQRIKDLPLCGAAVQLETFSVKHN
NT seq 1966 nt   +upstreamnt  +downstreamnt
atgttgaacttgaaggacagtgaagaacatctgcagcggaaagcagtcgtggctcaagct
atccaagacacagggacgtaccacatagagtatgatgaacttgtctttggtgccaaaact
gcctggcgaaatgcctcacgttgctcagggagaattcaatggaaaaaccttcaggtattt
gatgcacgtgagatacagacagctgaggaaatgttcagagcgatttgccgtcacctcacc
tgggcaacaaacggaggaaatatcaggtctgccatgacggtgtttccagcacgcacaaac
aagaagaaagactttagaatttggaactctcagtttatccgttatgctggatacaggatg
ccaggaggacatattattggggatccatccaatttatcatttactcaaatttgtgaaagg
ttgggttggaaggggaaaggtggccattttgacgtccttcctttggtactctctgcaaat
ggggaactgcctgaactgtttgagattcccaaagaaataatattggaggtggaactgaca
catccgagatttgactggttcaaagagttggggctgaagtggtatgccgtacctgttgtt
tcaaacatgctatttgactgcggagggttggagtttcctgctgcaccattcaatggctgg
tacatgggcacagaaataggggcaagaaacctatgtgatgtacagaggtacaacattctg
gagatagtgggtcagcatatggggctggactgcaggtcctctgtgaacctgtggaaagac
ctggcactggtggaggtgaatattgcagtactgcacagttaccagaaagccggggtgtcc
atagtagaccaccacactgtggctgaaagttttgtgcaattcatgcttcaagaggccaag
acccgtggtggctgtcctgctgactgggtgtggattgtgccccccatcagtgggagcatt
acgccagtttttcatcaagaaatggtcaactataccatcaaaccttcatttgattatcag
gaggatccaccattactgctactgaatcagttagacaaagagaaaaatatgaagaacttg
gtgtttggaattttcagggctgttctcttggctacaaagctaaaaatgaaaattcggaag
tgcaggcctagatgcctcattctgtttgcttcagagactggaaaatctgaacaatttgca
agaagattggaagcaacaatgggaagagccttcaatgcgaggacagtgtgtatggaagac
taccctgtctacaacttccttcaagaacagctagttctagtggtgaccagtacatttgga
ctgggcagtcctccactaaatggagagacattcttcagagctctagaatcctttgaaaag
aatctgtccaatataaggtttgcagtgtttggcctgggctccaaagcctaccctcgattc
tgtgcatttgctgtgcacattgataaccttctgaggaaccttggcggtcagcgcatgacc
tcactagtgaaagcggacagtctgagtggacaagaaaaaccctttgttaagtggtccagg
caggtttacaatgaagcttgtgctttgtatgggttgttgactttcaaacacgctgatgac
atcgaagtgaccactgaatggcatgaagagagatttcgttacacagtggtcggcaaagag
gagaacattatcaagggtctctctgaaatacatgggtaccagatgcagtccttcaacata
ataagttctacaaatctgcaggcaaaaagttctggactgagaacactgtcagttaaactg
cagagcaccaccaacaaagacaagctggtttaccaacatggagaccacatgttaatcttc
cctaccaacaacattgccatggtgacagctatcattcaacgaatcaaagacctacctcta
tgtggcgcagctgtccaactagagaccttctcagtgaaacataatg

DBGET integrated database retrieval system