KEGG   Lingula anatina: 106168839Help
Entry
106168839         CDS       T04921                                 

Definition
(RefSeq) glycogen [starch] synthase-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lak  Lingula anatina
Pathway
lak00500  Starch and sucrose metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106168839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lak01003]
    106168839
Enzymes [BR:lak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106168839
Glycosyltransferases [BR:lak01003]
 Polysaccharide
  Storage polysaccharide
   106168839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 106168839
NCBI-ProteinID: XP_013403502
UniProt: A0A1S3IZ75
LinkDB All DBs
Position
Unknown
AA seq 700 aa AA seqDB search
MRRVRSGSFARSLRSVEPEFDDYVLDRGDRAESQNKFVFECAWEVANKVGGIYTVIKTKA
GISVDELGEQYCLLGPYNESCVRTEVEIIEPSFAPLKDTIYQMRDKGIKVIFGRWLIEGY
PKVVLFDIGSAAWKLDEWKREIWESCHIGIPWHDREANDAVILGALVAWFLGEFRKNIEG
VDPPPLIIAHFHEWLAGMGLVMTRTRHLDVATVFTTHATLLGRYLCAGSTDFYNSLDKFD
LDKEAGDRGIYHRYCMERSAVHCAHVFTTVSQVTGLEANYLLKREPDVITPNGLNVYKFS
ALHEFQNLHAKAKEKIHDFVRGHFHGHYDFQLDKTLYFFIAGRYEFSNKGADMFIESMAR
LNYYLQQAGSDVTVIAFLIFPTRTNNFNVESLRGQAIAKQLRDTVHNVQANIGKRIFETC
LQGKIPSGEDVLQQEDIVQLKRCIFASQRHSLPPVSTHNVVDDGIDPVLCAIRRCQLFNR
GQDRVKVIFHPEFLSSTSPLLGMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVT
TNLSGFGCFMAEHIADPMSYGVYIIDRRMKTAEESIQQLAQYMFDFCRLSRRQRIIQRNR
TERLSDLLDWKNLGIYYRKARNMALQKLHPELFQEDPNTGRIFMPRPASEPPSPSHSRSS
TPIPSDTDEKDDEDDDDEDDHDDEEEKEILSRKDDEEDHY
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagtcaggtctggaagctttgcccggtcgttgcgaagtgttgagccagaattt
gatgactatgtgctagataggggtgaccgtgcagaatctcaaaacaagttcgttttcgag
tgtgcatgggaagttgcaaacaaagttggtggtatctacacagtaattaagaccaaagca
gggatcagtgtggatgaactaggagagcagtactgtttacttggaccatacaatgaatcc
tgtgtcaggacagaagttgaaatcattgagccgtcatttgctcctctcaaggataccatt
taccaaatgcgcgataagggaatcaaggtaatatttggccgctggttgattgaaggttac
ccaaaggttgtactctttgacattggatcagcagcatggaaattagatgaatggaaacgt
gaaatctgggaatcctgccacataggtattccttggcatgaccgggaagcaaatgatgct
gtcatcttaggggcactggtggcttggtttcttggagagtttcgcaagaacatagaaggt
gttgacccacctcctcttatcattgctcactttcacgagtggctagcaggaatgggtctg
gtgatgaccaggacacgacacttagatgtggccactgtgttcaccacacatgcaactctg
ctgggaagatacttgtgtgcaggatccactgatttttataactctttggacaagtttgat
ttggataaagaagcaggtgatcgtggcatatatcatcgatactgcatggaaaggtctgca
gttcactgtgctcatgtgtttactacagtatcacaggtgacaggacttgaagccaactac
ctactcaagagagaaccagatgtaatcaccccaaatggactcaatgtatacaagttcagt
gccttgcatgagtttcaaaacctacatgctaaagccaaggaaaagatccatgattttgta
agaggacattttcatggccactatgactttcaattagataagacactttacttcttcatt
gctggccgctatgagttttcaaacaagggtgctgatatgtttattgagtcaatggcaagg
ttaaattattacttacagcaagctggaagtgatgtgacagtgatagccttcctgatcttc
cctaccaggaccaacaacttcaatgtggaatccctgcgaggccaggccattgccaaacaa
ctcagagacactgtgcataatgtacaagccaatataggaaagaggatatttgaaacttgt
ttacaaggtaagattccctcaggggaggatgtgttacagcaagaagacattgtgcagttg
aagagatgtatatttgcttctcagagacacagtcttcccccagtgagcactcacaatgta
gtggatgatgggattgatcctgtactttgtgcaataaggaggtgccaactctttaacagg
ggtcaagacagagttaaggttatatttcatccagagtttcttagctctactagcccttta
ttgggaatggactatgaagaatttgtgcgtggctgtcatctaggagttttcccctcttat
tatgagccctgggggtacacaccagctgaatgtaccgtgatgggaatcccaagtgttacc
accaacctgtccgggtttggttgctttatggcagaacacattgctgatccaatgtcctat
ggagtctatattatagacaggagaatgaaaactgcagaggaatccatccaacaactagct
caatacatgtttgacttttgtcgtctgtcacgaaggcagcgtatcatccagagaaacaga
actgagagactgagtgatcttctggattggaagaatctaggaatttattatagaaaagca
agaaatatggctttgcaaaaacttcatcctgaattgttccaagaagatccaaatactggt
cgtatcttcatgcccagacctgcctcagaacccccctctccgtctcactcccgctcttcc
actccaataccctcagacacagacgagaaagacgatgaagatgatgatgatgaagatgat
catgatgatgaagaggaaaaagaaatcttgagtagaaaagatgacgaagaagaccattat
taa

DBGET integrated database retrieval system