KEGG   Lingula anatina: 106176019
Entry
106176019         CDS       T04921                                 

Definition
(RefSeq) nitric oxide synthase, inducible isoform X1
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lak  Lingula anatina
Pathway
lak00220  Arginine biosynthesis
lak00330  Arginine and proline metabolism
lak01100  Metabolic pathways
lak04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106176019
   00330 Arginine and proline metabolism
    106176019
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106176019
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106176019
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF3715 Flavodoxin_5
Other DBs
NCBI-GeneID: 106176019
NCBI-ProteinID: XP_013413681
UniProt: A0A1S3JUA9
LinkDB
Position
Unknown
AA seq 1059 aa
MKKLALRNYTNGTVMTDTLHKESKQSICPMASICTGAFVIKPSTVPPQEATDRNNDQIQV
EALDFIDQYYCHLNRKDSEEHLQRKVVVAQAIQDTGTYHIEYDELVFGAKTAWRNASRCS
GRIQWKNLQVFDAREIQTAEEMFRAICHHLTWATNGGNIRSAMTVFPARTNKKKDFRIWN
SQFIRYAGYRMPGGHIIGDPSNLSFTQICERLGWKGKGGHFDVLPLVLSANGEPPELFEI
PKEIILEVELTHPRFDWFKELGLKWYAVPVVSNMLFDCGGLEFPAAPFNGWYMGTEIGAR
NLCDVQRYNILEIVGQRMGLDCRSSVNLWKDLALVEVNIAVLHSYQKAGVSIVDHHTVAD
SFVQFMLQEAKTRGGCPADWVWIVPPISGSITPVFHQEMVNYTIKPSFDYQEDPPLLLLN
QLDKEKNMKNLVFGIFRAVLLASKLKMKIRKCRPKCLILFASETGKSEQFARRLEATMGR
AFNARTVCMEDYPVNSFLQEQLVLVVTSTFGLGSPPLNGETFFRALESFEKNLSNIRFAV
FGLGSKAYPRFCAFAVHIDNLLRNLGGQRMTSLVKADSLSGQEKPFVKWSRQVYNEACAL
YGLLTFKHADDIEVTTEWHEERFRYTVVGKEEDIIKGLSEIHGYQMQSFNIISSTNLQAK
SSGLRSLSVKLQSTTNKDKLVYQHGDHMLIFPTNNIAMVTAIIQRIKDLPLCGAAVQLET
FSVKHNAWGSHPRLPPCTIQMALLHYLDITKPPTQDMLKGLAQLATNNKEHNRLITLAKN
EEAYLQWRDYKMPTIVDVLSEFQSIQLPVAFLLSQLPILEPRCFSVSSSPDVHPNEIHLT
VGVLQYRTNDGRLHDGLCTTWLENLGQNNNTTTIPCAIKLHKTFQLPHDAGVPVLMLGIG
TGIAPFRGFWQHRYYQMIHPMPGIKFGPMTLFHGCRQKGVDDLYSQEISLMQESKVLTSV
HYAYSRMPGQPRIYIQHLLCEQAQTTYEQLVVQEGHIYICGSITMAMDVRKTLLNILCEE
GNMTTDKAQNYMELLRKSGRYHEELFGLGYPHHRLNHIK
NT seq 3180 nt   +upstreamnt  +downstreamnt
atgaagaaactggcgctgaggaactacacgaacgggaccgtcatgacggacacgcttcac
aaagaatctaaacagtccatttgcccaatggcatccatttgcacaggtgcctttgtcatc
aaaccgtcaactgtaccaccacaagaagcaacagatcgcaataacgaccaaatccaggtc
gaggctctcgacttcattgatcagtattattgccatcttaaccgaaaggacagtgaagaa
catctgcagcggaaagtagttgtggctcaagctatccaagacacagggacgtaccacata
gagtatgatgaacttgtctttggtgccaaaactgcctggcgaaatgcctcacgttgctct
gggagaattcaatggaaaaaccttcaggtatttgatgcacgtgagatacagacagctgag
gaaatgttcagagcgatttgccatcacctcacctgggcaacaaacggaggaaatatcagg
tctgccatgacggtgtttccagcacgcacaaacaagaagaaagactttagaatttggaac
tctcagtttatccgttatgctggatacaggatgccaggaggacatattattggagatcca
tccaatttatcatttactcaaatttgtgaaaggttgggttggaaggggaaaggtggccat
tttgacgtccttcctttggtactctctgcaaatggggaaccgcctgaactgtttgagatt
cccaaagaaataatattggaggtggaactgacacatccgagatttgactggttcaaagag
ttgggactgaagtggtatgcagtacctgttgtttcaaacatgctatttgactgtggaggg
ttggagtttcctgctgcaccattcaatggctggtacatgggcacagaaataggggcaaga
aacctatgtgatgtacagagatacaacattctggagatagtgggtcagcgtatggggctg
gactgcaggtcctctgtgaacctgtggaaagacctggcactggtggaggtgaatattgca
gtactgcacagttaccagaaagccggggtgtccatagtagaccaccacactgtggctgac
agttttgtgcagttcatgcttcaagaggccaagacccgcggtggctgtcctgctgactgg
gtgtggattgtgccccccattagcgggagcattacgccagtttttcatcaagaaatggtc
aactataccatcaaaccttcatttgattatcaggaggatccaccattactgctactgaat
cagttagacaaagagaaaaatatgaagaacttggtgtttggaattttcagggctgttctc
ttggcttcaaagctgaaaatgaaaattcggaagtgcaggcctaaatgcctcattctgttt
gcttcagagacagggaaatctgaacaatttgcaagaagattggaagcaacaatgggaaga
gccttcaatgcaaggacagtgtgtatggaagactatcctgtcaacagcttccttcaagaa
cagctagttctagtggtgaccagtacatttggacttggcagtcctccactaaatggagag
acattcttcagagctctagaatcctttgaaaagaatctgtccaatataaggtttgctgtg
tttggcctgggctccaaagcctaccctcgattctgtgcatttgctgtgcacattgataac
cttctgaggaaccttggcggtcagcgcatgacctcactagtgaaagcggacagtctgagt
ggacaagaaaaaccctttgttaagtggtccaggcaggtttacaatgaagcttgtgctttg
tatgggttgttgactttcaaacacgctgatgacatcgaagtgaccactgaatggcatgaa
gagagatttcgttatacagtggtcggcaaagaggaggacattatcaagggtctctctgaa
atacatgggtaccagatgcagtccttcaacataataagttctacaaatctgcaggcaaaa
agttctggactgagatcactgtcagttaaactgcagagcaccaccaacaaagacaagctg
gtttaccaacatggagaccacatgttaatcttccctactaacaatattgccatggtgaca
gctatcattcaacgaatcaaagacctacctctatgtggcgcagctgtccaactagagacc
ttctcagtgaaacataatgcatggggttcacaccctcgccttcccccatgtaccatccag
atggcgctgctgcactacctggatatcacgaaacccccaacacaagacatgcttaaaggt
ttggcacaactggcaacaaacaacaaggaacacaacagactcataacactggcaaagaac
gaagaagcatatctacagtggagggactacaagatgccaaccattgtagatgtcctgagt
gagtttcagtccatacaattgcctgtggcatttttgttgagtcagctgcctattttggag
cctcgctgtttcagtgtcagttcctcccctgatgtgcacccaaacgaaatccatttgaca
gttggggtcctgcagtacaggacaaatgatggcaggctccatgatgggttgtgtacaact
tggctggaaaatctcggacaaaataacaacacaacaaccattccctgtgcaattaaatta
cacaagacgttccagcttccccatgatgcaggtgttcctgttctaatgcttggcataggt
actggcatagctcctttcagagggttctggcagcacagatactaccaaatgatccaccca
atgcctggtatcaaattcggaccaatgactctgttccatggctgcagacagaaaggtgtg
gatgatctctacagccaagaaatctccctgatgcaggaaagcaaagtcttgaccagtgtc
cactatgcatactctagaatgcctggacaaccacggatttacattcaacacctcctctgt
gagcaagctcaaacaacctatgaacagctggtagttcaagaaggccatatctacatctgt
ggaagtataactatggctatggatgtcagaaagacattactgaatattctgtgtgaagag
ggcaacatgacaactgacaaggctcagaattacatggaacttcttagaaaatctggtcgg
tatcatgaagagctgtttgggttgggttatccacaccacagactgaatcacatcaaatag

DBGET integrated database retrieval system