KEGG   Loxodonta africana (African savanna elephant): 100653633Help
Entry
100653633         CDS       T04351                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00590  Arachidonic acid metabolism
lav01100  Metabolic pathways
lav04611  Platelet activation
lav04726  Serotonergic synapse
lav04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100653633 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100653633 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100653633 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    100653633 (PTGS1)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100653633 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100653633
NCBI-ProteinID: XP_003407539
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MSRRSLSLRFPLLLLLLPTPPVLAAASRAPAPVNPCCSYPCQHQGICVRIGLDLYQCDCT
RTGYSGPNCTVPDLWTWLRNALRPSPSFLHFLLTHGRWFWEFVNATFIREMLMRLVLVVR
SNLVPSPPTYNSAHDYISWESFSNLTYYTRILPSVPQDCPTPMGTKGKKQLPDAQLLAHR
FLLRRKFIPDPQGANLMFAFFAQHFTHQFFKTSGKMGPGFTKALSHGVDLGHIYGDNLER
QYHLRLFKDGKLKYQVLDGDVYPPSVEEAPVLMHYPRNVSPRSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWNDEQLFQTTRLILIGETIKIVIEEYVQQLSGYLLQLK
FDPELLFGVQFQYSNRIAVEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVE
ALVDAFSRQGAGKIGGGQNLDQHVLHVAVEVIKQSRELRLQPFNEYRKRFGMRPYTSFEE
LTGEKEMAAELEELYGDIDAMEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKPSTFGGETGFNIVKTATLKKLVCLNTKTCPYVSFHVPDPSRDDWFTVERPSTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcgcagtctctcgctccggttcccgctgctcctgttgctgctgccgacgccc
ccggtcctcgcggctgcctcccgggcccccgcgccggtgaacccctgttgttcgtatccg
tgccagcaccagggaatctgcgtccgcattggtcttgatctctaccagtgtgactgcacc
cgcacgggctactccggccccaactgcaccgtccctgatctatggacctggctccggaat
gcattgcggcccagcccctcttttctccacttcctgttgacccatgggcgctggttctgg
gagtttgtcaatgccaccttcatccgtgaaatgctcatgcgtctggtactcgtagtgcgt
tccaaccttgtccccagccccccaacctacaactcagcccatgactacatcagctgggag
tccttctccaatctgacctactatacccgtattctgccctctgtgccccaagactgccct
acaccaatgggaaccaaagggaagaagcagttgccagatgctcagctcctggcccatcgc
ttcctgctcaggaggaagttcatacctgatccccaaggtgccaacctcatgtttgccttt
tttgcacaacattttacccaccaattcttcaaaacttctggcaagatgggtcctggcttc
accaaggccttgagccacggggtagacctgggccacatttatggagacaatctggagcgt
cagtatcatctgcggctctttaaggatgggaaactcaagtaccaggtgctggatggagac
gtgtaccccccctcggtggaagaggcacctgtgttgatgcactatccacggaatgtttcg
ccacggagccagatggctgtgggccaggaggtgttcgggctgcttcccggcctcatgctc
tatgccacaatctggctgcgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcac
cccacctggaacgacgagcagctcttccagacgacccgcctcatccttataggcgagacc
atcaagatcgtaattgaggagtatgtgcagcagctgagtggctacctcctgcagctgaag
tttgacccggagctgctgttcggtgtccagttccagtatagcaatcgcattgccgtggag
ttcaaccacctctaccactggcacccactcatgcccgactccttcaaagtgggctcccaa
gagtacagctatgagcagttcttgttcaacacctcaatgttggtggactacggcgttgag
gccctagtggatgccttctctcgtcagggcgctggcaagatcggtggcggtcagaacttg
gaccagcatgtcctgcatgttgccgtggaggtcatcaagcagtctcgagagttgcggctg
cagcccttcaatgagtaccgaaagaggtttggcatgaggccctacacctctttcgaggag
ctcacaggagagaaggagatggcagctgagttggaagagctatatggtgatatcgatgcc
atggagttctatccggggctgcttcttgagaagtgccatccaaactccatctttggggag
agtatgatagaaattggggctcccttttccctcaagggcctcctagggaatcccatctgt
tctccggagtactggaagcccagcacatttggcggcgagacaggtttcaacattgtcaag
actgccacactgaagaagctggtctgcctcaacaccaaaacctgtccttatgtttccttc
catgtgcctgaccccagtcgggatgactggtttactgtggagcggccgtccacagagctc
taa

DBGET integrated database retrieval system