KEGG   Loxodonta africana (African savanna elephant): 100653879
Entry
100653879         CDS       T04351                                 

Gene name
MOS
Definition
(RefSeq) proto-oncogene serine/threonine-protein kinase mos
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04114  Oocyte meiosis
lav04810  Regulation of actin cytoskeleton
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100653879 (MOS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100653879 (MOS)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100653879 (MOS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100653879 (MOS)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100653879 (MOS)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  MOS family
   100653879 (MOS)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 100653879
NCBI-ProteinID: XP_003420061
UniProt: G3SXP8
LinkDB
Position
Unknown
AA seq 344 aa
MPSPLSVRRVLPGELSPSGDSRPCSSPCERPGRRGQRVLGGTPPRAPRLPRRLAWCSIDW
EQVRFLQRLGAGGFGSVYKATYHGLPVAIKQVNKSTKNRLASQRSFWAELNIARLHHDNI
VRVVAASTRTPAGFNSLGTIVMEFGGNTTLHQLIYGATGLPEEPSCSAGGLLSLTKCLKY
SLDVVKGLMFLHSQSIVHLDLKPANILISEEDVCKIGDFGCSQRLEGLLGFHAPHHLGGT
YTHRAPELLKGETITPKADIYSFAITLWQMTTKGVPYSGERQYVLYAVVAHNLRPSLSVA
VFTDSVLGQRLEKIIQSCWGASTSQRPNAELLFVDLNSLKSEFC
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgccctcgcccctgtctgtgcgccgtgtcctcccgggcgagttgtctccctctggggac
tcgcggccctgcagcagcccctgcgagcgcccagggcggcggggacagcgcgtcctgggt
ggcacccctcccagggcacctcggctgccccgccgcctggcctggtgctccatcgactgg
gaacaggtgcgcttcctgcaaaggctgggcgctggaggctttggctcggtctacaaggcc
acttaccatgggcttcccgtggccataaaacaagtgaacaagagcaccaagaaccgactg
gcgtcgcagcgaagcttttgggctgagctcaacatagccaggctccaccacgacaacatc
gtgcgggtggtagctgccagtacgcgcacgcccgcgggttttaatagtctaggcaccatc
gtcatggagttcgggggcaacaccactttacaccaactcatctacggggctaccggcctc
cccgaggagccttcctgctctgctggagggctgttaagtctgacaaagtgtctcaagtat
tccctcgatgttgtgaagggcctgatgttccttcactcacaaagcatcgtgcacttggac
ctgaaaccagcgaacattctgatcagcgaagaggacgtctgcaaaattggggactttggt
tgctcgcagaggctggaaggtctgctaggcttccacgctcctcaccacctaggcggtacc
tacacccaccgcgccccagagctcctgaaaggagagaccataactcccaaagctgacatc
tattcttttgccataactctctggcagatgacgaccaagggggtgccttactcaggggag
cgacagtatgtgctctatgctgttgtggcccacaaccttcgcccatctctctcagtggct
gtcttcacggactctgtcctgggccaaaggcttgagaagatcatccagagctgctgggga
gccagtacttcccagaggccaaatgcagagcttctctttgttgaccttaactctttaaaa
tctgagttctgctga

DBGET integrated database retrieval system