KEGG   Loxodonta africana (African savanna elephant): 100654071
Entry
100654071         CDS       T04351                                 

Gene name
ANAPC7
Definition
(RefSeq) LOW QUALITY PROTEIN: anaphase-promoting complex subunit 7
  KO
K03354  anaphase-promoting complex subunit 7
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100654071 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100654071 (ANAPC7)
   04114 Oocyte meiosis
    100654071 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100654071 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100654071 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100654071 (ANAPC7)
   03036 Chromosome and associated proteins [BR:lav03036]
    100654071 (ANAPC7)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100654071 (ANAPC7)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100654071 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_14 TPR_1 TPR_19 TPR_16 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_21 TPR_17 TPR_10 BTAD
Other DBs
NCBI-GeneID: 100654071
NCBI-ProteinID: XP_003420349
LinkDB
Position
Unknown
AA seq 595 aa
MDPGGAAILEASLGRLYRPSVTLPAASSGRMNVIDHVRDMAAAGLHSNVRLLSSLLLTMS
NNNPELFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTGNSA
STPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGQ
ERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYA
FVHTGDNSRAINTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLDPYL
IKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAK
AIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIR
EAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAE
LLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQK
SLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEQPSXADQEQWFGMQ
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggaccccggcggggccgccattttggaggcctctctagggcgcctgtaccggccttcg
gtgacgctgcctgcggcttcgtcgggtagaatgaacgtgatagaccacgtgcgggatatg
gcggccgcggggctgcactccaacgtgcggctcctcagcagcttgttactgacgatgagt
aacaataaccctgagctgttctccccatctcagaagtaccagcttttggtatatcacgca
gattctctctttcatgacaaggagtatcgcaatgctgtgagtaagtacaccatggctttg
cagcagaagaaagccctgagtaaaacttccaaagtgagaccttcgactggaaattctgca
tctactccacagagtcagtgtcttccatctgaaattgaagtgaaatacaaaatggctgag
tgctatacaatgctaaaacaagataaagatgctattgccatactcgatgggataccttca
agacaaagaactcccaaaataaacatgatgctggcaaacctctacaagaaggccggccag
gagcgcccctctgtcaccagctataaagaagtgctaaggcagtgcccgttagctcttgat
gccattctaggtttgctgtccctttctgtaaaaggtgcagaggtggcatccatgacaatg
aacgtgatccagaccgtgcctaacttggactggctctctgtgtggatcaaagcatatgct
tttgtgcacactggtgacaactcgagagcgattaataccatctgttcactggagaaaaag
tccttactgcgggataacgtggacctgctgggaagcttagccgatctgtacttccgagct
ggagacaataagaactctgtcctcaagtttgaacaggcgcagatgttggatccttatctg
atcaaaggcatggatgtgtatggctacctcctggctcgagaagggcgtctggaggacgtg
gagaacctcggctgccgccttttcaacatttcggaccagcacgcagaaccctgggtggtc
tctgggtgtcacagcttctacagcaaacgctactcccgggccctctacttaggggccaag
gccattcagctcaacagtaatagcgttcaggctttgctactgaagggagcagcacttagg
aacatgggcagagtccaagaagccataatccacttccgcgaggccatacggctcgcccct
tgtcgcttagattgttatgaagggctcatcgaatgttacttagcctccaacagtattcgt
gaagcgatggtaatggcgaacaacgtttacaaaactctgggagcgaatgcacaaaccctc
acccttttagccactgtttgtcttgaagacccagtcacacaggagaaagccaaaacgtta
ttagataaagccctgacccagaggccagactacattaaagccgtggtgaaaaaagcagag
ctacttagcagagaacagaaatacgaagatggaattgctttgctgaggaacgcactggct
aatcagagtgactgtgtcttgcatcggatcctaggagatttccttgtagctgtcaatgag
tatcaggaagcaatggaccagtatagtatagcgctaagtttggaccccaatgaccagaag
tctctagaggggatgcagaagatggagaaggaagagagtcccacggatgccactcaggag
gaggatgtggacgacatggaagggagtggggaagaaggggacctggagggcagcgacagt
gagcagcccagtnnggccgaccaggagcagtggttcggcatgcagtga

KEGG   Loxodonta africana (African savanna elephant): 100656382
Entry
100656382         CDS       T04351                                 

Gene name
ANAPC2
Definition
(RefSeq) anaphase-promoting complex subunit 2 isoform X1
  KO
K03349  anaphase-promoting complex subunit 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100656382 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100656382 (ANAPC2)
   04114 Oocyte meiosis
    100656382 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100656382 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100656382 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100656382 (ANAPC2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100656382 (ANAPC2)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     100656382 (ANAPC2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100656382 (ANAPC2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 100656382
NCBI-ProteinID: XP_003423615
LinkDB
Position
Unknown
AA seq 822 aa
MAAEAAGAKGDCDPAPGQELLVAWNTVSTGLVPPAALGLAFSRTSGAVQPKEEELRAAVE
VLRGHGLHSILEEWFVEVLQNDLQANISPEFWNAISQRENSADEPQCLLLLLDAFGLLEN
RLDPYLRSLELLEKWSRLGLLMGTGAQGLREKVHTMLRGVLFFSTPRTFQEMIQRLYGRF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCGSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKAFLQDGPARPASPEAGHTLRRWRCHVQRFFYRVYAGMRIQELFSIIRDFPDSRPAIED
LKYCLERTNQRQQLLESLKAALETRLLHPGVNTCDIITLYISAIKALRVLDSSMVILEVA
CEPVRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIKEALDVYCKKYEKLKAMRTLSWKHTLGLVTMDVELTDRTLSVAVT
PVQAVILLYFQDQATWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLMDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLERIYSMLRMF
VMTGPALAEIDLQELQSYLQKKVRDHQLIYSAGVYRLPKNCG
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggctgcagaggcggcgggggcgaagggggactgcgaccccgcgcccggacaggagctg
ttggtggcctggaacaccgtgagcaccgggctggtgccgccggctgcgctggggctggcg
ttctctcggaccagcggtgcggtgcagccaaaggaggaggagctccgggcggctgtggag
gttctgcggggccacggcctgcactcaatcctggaggagtggttcgtggaggtgctgcag
aacgacctgcaggctaacatctcccccgagttctggaatgccatctcccagcgcgagaac
tccgcggacgagccccagtgccttctgctgctccttgacgcttttggcctgttggagaat
cgcctggatccctacctgcgtagcttagagctcctggagaaatggtctcgcctgggattg
ctgatgggcactggcgcacaggggctgcgggagaaggtccacaccatgttgcggggtgtt
ctgtttttttccactcccagaactttccaggagatgatccaacgtctctacgggcgcttc
ttgagagtctatatgcagagtaagaggaagggggaaggaggcaccgacccagaactggag
ggggagttggatagccgatatgctcgccgccgttactaccggctcctgcagagcccactc
tgtgccgggtgtggcagtgacaagcagcagtgttggtgtcgccaggccctggagcagttc
caccagctcagccaggtcctacacagactcagtttgctggaacgggtcagtgccgaggct
gtgaccaccacgctgcaccaggtgacccgggagaggatggaggaccgctgccggggcgag
tacgaacgctccttcctacgggagttccacaagtggatcgagagggtggtcggctggctt
ggcaaggcgttccttcaggatggccctgccaggcccgcatccccggaggctggccacacg
ctgcgccgctggcgctgccacgtgcagaggttcttctaccgcgtctatgccggcatgcgc
atccaggagcttttcagcatcatccgagacttcccagactcacggccagccattgaggac
ctcaagtactgcctggagaggaccaaccagaggcagcagctgctcgagtcgctcaaggcg
gcactggagacccggctcctgcacccaggcgtgaacacatgtgacatcatcacgctgtac
atctctgctatcaaggcactgcgtgtgctggattcttccatggtcatcttggaggtggcc
tgtgagcccgtccgccgctacctgaggacacgggaggacacagtgcggcagattgtggcc
ggtctgactggggactctgatgggactggggacttggctgtcgagctgtccaagaccgac
cctgcgagcctggagactggccaggacagtgaggatgactctggtgaacctgaggactgg
gttcctgaccctgtggatgccgacccagggaagtcaagctccaagcggcggtcttcggac
atcatcagcctgctggtcagcatttatggcagcaaagatctcttcatcaatgagtaccgt
tctctgcttgctgaccgccttctgcaccagttcagcttcagcccggagcgggaaatccgc
aatgtggagctgctgaagctacgctttggcgaggccccgatgcacttctgtgaggtcatg
ctgaaggacatggcggactcgcgacgcatcaatgccaacatccgcgaggaggacgagaag
cgcccggcagaggaacagccaccctttggggtctatgcggttatcctgtccagtgagttt
tggccccccttcaaggacgagaagctggaggtccctgaagacatcaaggaggctttggat
gtctactgcaagaagtacgagaagctgaaggccatgcggaccctcagctggaagcatact
ctgggcctggtgaccatggacgtggagctgactgaccgcacactgtctgtggccgtgacc
cctgtgcaggctgtgatcctgctgtacttccaggatcaagccacctggactctggaggag
ctgagcaaggcagtgaagatgccagtggcgctgctgcggcggcgcatgtctgtctggctg
cagcagggtgtgctgcgggaggagcccccgggcaccttctcagtcattgaggaggaacgg
ccccaggaccgggacaacatggtgctcatggacagtgatgatgagagcgactcgggcatg
gcctcccaggcagaccagaaggaggaggagctgctgctcttctggacgtacattcaggcc
atgctgaccaacctggagagcctgtccctggagcgtatctacagcatgctgcgcatgttc
gtcatgaccggccctgccctggccgagatcgatctgcaggagctgcagagctacctacag
aagaaggtgcgcgaccaccaactcatctactcagctggcgtctaccgcctgcccaaaaac
tgtggctga

KEGG   Loxodonta africana (African savanna elephant): 100659806
Entry
100659806         CDS       T04351                                 

Gene name
CDC26
Definition
(RefSeq) anaphase-promoting complex subunit CDC26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100659806 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100659806 (CDC26)
   04114 Oocyte meiosis
    100659806 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100659806 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100659806 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100659806 (CDC26)
   03036 Chromosome and associated proteins [BR:lav03036]
    100659806 (CDC26)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100659806 (CDC26)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100659806 (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 100659806
NCBI-ProteinID: XP_003407845
UniProt: G3T1T2
LinkDB
Position
Unknown
AA seq 85 aa
MLRRKPTRLELKLDDIEEFESIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQPKPNNRSSQFGSFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgcttcgacgaaaaccaacccgcctggagctgaagcttgatgacattgaggagtttgag
agcattcgaaaggacctggagacccgtaagaaacaaaaggaagatgtggaagttgtggga
ggaagtgatggagaaggagccattgggcttagcagtgaccccaagagccgagaacaaatg
attaatgatcgaattggttataaaccccaacccaagccgaacaatcgttcgtctcaattt
ggaagttttgagttttag

KEGG   Loxodonta africana (African savanna elephant): 100660117
Entry
100660117         CDS       T04351                                 

Gene name
CDC27
Definition
(RefSeq) LOW QUALITY PROTEIN: cell division cycle protein 27 homolog
  KO
K03350  anaphase-promoting complex subunit 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100660117 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100660117 (CDC27)
   04114 Oocyte meiosis
    100660117 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100660117 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100660117 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100660117 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100660117 (CDC27)
   03036 Chromosome and associated proteins [BR:lav03036]
    100660117 (CDC27)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100660117 (CDC27)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100660117 (CDC27)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100660117 (CDC27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs PPTA TPR_MalT TPR_21 TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 100660117
NCBI-ProteinID: XP_010592842
LinkDB
Position
Unknown
AA seq 826 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVLNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLLQNFSNC
LPNSCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAV
ISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQ
NYTNTTSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSSGPQTST
TPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGI
TQPNINDSLEITKLDSSIISEGKISTITPQIQAFTLQKAAAEGLMSLLREMGKGYLALCS
YNCKDAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEI
YSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDP
NYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHF
QKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEK
YKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEA
IDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatatggcaagcactaaaccactatgca
taccgagatgcagttttccttgcagaaagactgtatgcagaagtacactccgaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatacagactc
ttgaaaggacacagttgtactacaccgcaatgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggagtgttaaataagcag
aaaagccatgatgatattgttaccgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcgacttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttattacagaactttagtaattgt
ctgcccaactcttgtacaacactagtatctaatcatagtttatctcacagacaacctgag
acagttcttacggaaacaccccaagatacaattgaattaaacagactgaatttagaatct
tccaattcaaagtactccttaaatacagattcctcggtgtcttatattgattcagctgta
atttcaccagacactgtccctcttggaacgggaacttccatattatctaaacaggttcaa
aataaaccaaaaactggtcggagtttactaggaggaccagctgctcttagtccattaacc
ccaagttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaa
aactacactaatacaacttctgtaattgatgtgccatctaccggagccccttcaaaaaag
tctgttgccagaatcggccaaaccggaacaaagtctgtattctcacagagtggaaatagt
cgagaggtaactccaattcttgttgcacaaacacaaagttctggcccacaaacaagtaca
acacctcaggtattgagccccactatcacatctcccccaaacgcactgcctcgaagaagt
tcacgactttttactagtgacagctccacaaccaaggagaatagtaaaaaattaaaaatg
aagtttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaata
actcagcctaacataaatgatagcctggaaattacaaaactggactcttccatcatttca
gaagggaaaatatccacaatcacaccgcagatccaggcttttactctacagaaagcagca
gcagaaggtttgatgagccttcttcgtgaaatggggaaaggttatctagctttgtgttcg
tacaactgcaaagatgctataaatatactgagccacctaccttctcaccactacaatacg
ggttgggtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaggct
gaaagaatattctcagaggttagaaggattgagaattatagagttgaaggcatggagatc
tactctacaacactttggcatcttcaaaaagatgtcgctctttcagttctttcaaaagat
ttaacagacatggataaaaattcaccagaggcctggtgtgctgcagggaactgtttcagt
ttgcaacgggaacatgatattgcaattaaattcttccagagagctatccaggttgatcca
aattatgcttatgcctatactctgttaggtcatgagtttgtgttaactgaagaactagac
aaagcattagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatgg
tatggtttgggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttc
cagaaagcacttgatatcaaccctcaaagttcagttttgctttgccacattggagtagtt
caacatgcactgaaaaaatctgagaaggctttggataccctaaataaagccattgttatt
gaccccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaa
tataagtctgctttacaagaacttgaagaactgaaacaaattgttcccaaagaatccctc
gtttacttcttaataggaaaggtttacaagaagttaggtcagacgcacctcgccctgatg
aatttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggca
attgataagcgctaccttccagatgatgaggagccaataactcaagaagagcagatcatg
ggaacagatgaatcccaggagagcagcatgacagatgcagatgacacacaacttcatgca
gctgaaagtgatgaattttaa

KEGG   Loxodonta africana (African savanna elephant): 100663426
Entry
100663426         CDS       T04351                                 

Gene name
CDC16
Definition
(RefSeq) cell division cycle protein 16 homolog
  KO
K03353  anaphase-promoting complex subunit 6
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100663426 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100663426 (CDC16)
   04114 Oocyte meiosis
    100663426 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100663426 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100663426 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100663426 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100663426 (CDC16)
   03036 Chromosome and associated proteins [BR:lav03036]
    100663426 (CDC16)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100663426 (CDC16)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100663426 (CDC16)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100663426 (CDC16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_11 TPR_19 TPR_16 TPR_9 SRP_TPR_like
Other DBs
NCBI-GeneID: 100663426
NCBI-ProteinID: XP_003413673
LinkDB
Position
Unknown
AA seq 620 aa
MNLERLRKRVRQYIDQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINKRLFEKYLKDESGLKDSSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCPEEQELLRFLFENKLKKYNKPSETAIPESVDGLRENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPGNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLERTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGDWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYDEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAIDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTVEETGLAPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHSS
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagcggctgcggaagcgcgtccggcagtacatcgaccagcagcagtatcaa
agtgctctcttttgggcagataaagtagcttccctctctcatgaggagccccaggacata
tattggttggcacagtgtctttacctgacagcgcaatatcacagagcagctcacgcactt
cggtcgcgaaaactagacaaattatatgaagcatgccgataccttgcggcccgatgtcat
tatgctgccaaagagcaccagcaggcacttgatatccttgatatggaggaaccaatcaac
aaaagattatttgaaaaatacttgaaggatgaaagtggcttgaaagactcctccagtgac
tgggaaatgtcacaatcttcaataaagagctctatttgtcttttaagagggaaaatctat
gacgctctggataaccgaaccctagctacgtacagctacaaagaagctttgaagcttgat
gtgtactgttttgaagcatttgatcttttaacgtcacaccacatgttgacagcacaagaa
gaaaaagagctgcttgaatcactacctctcagcaagctgtgtcctgaagaacaggaattg
ctacgttttctgtttgagaacaaattaaaaaagtataataagcctagtgaaaccgccatt
cctgagtctgtagatggcttgcgagagaatctggatgtggtagtatctttagctgagaga
cattattataactgtgacttcaaaatgtgctacaagcttacgtccgtagtcatggaaaaa
gatcctttccacgccagttgtttacctgtacacatagggacccttgtggaactgaataaa
gccaatgaactcttctatctttctcataaactggtggatttgtatcctggtaatcctgtg
tcttggtttgcagtgggatgttactatctcatggttggccacaaaaatgaacacgccaga
agatacctcagcaaagctacaacgcttgagagaacgtacgggcctgcctggatagcctat
gggcattcatttgcagttgagagcgagcatgaccaagccatggctgcttacttcacagcc
gcacagctgatgaaagggtgtcatttgccaatgctgtatattggattggagtatggcttg
accaataactcaaaattggctgaaagattctttagccaagcgctaagcattgcacctgaa
gatccatttgttatgcacgaggttggcgtcgttgcgtttcagaatggagactggaaaaca
gcagaaaaatggtttcttgacgctttggaaaaaattaaagcaattgggaatgaggtaaca
gttgacaaatgggaacctttgttgaacaacttggggcacgtctgcagaaaactgaaaaag
tatgatgaagcgttggattaccaccgccaggctctggtgctgattcctcagaacgcgtcc
acctactctgctataggatatatacacagcctgatgggcaattttgaaaatgctattgac
tatttccacacagcacttggtctcaggcgagatgacacattttccgttacaatgcttggt
cattgcattgaaatgtacattggcgactctgaagcttatattggagcagatattaaagac
aaattaaaatgttatgacttcgatgtgcatacaatgaagacactaaaaaacatcatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgtagaggaaacggggctc
gcaccactggaaacttcaaggaaaactccagattctaggccttccctggaagaaaccttt
gaaatcgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagctcg
tga

KEGG   Loxodonta africana (African savanna elephant): 100668375
Entry
100668375         CDS       T04351                                 

Gene name
ANAPC10
Definition
(RefSeq) anaphase-promoting complex subunit 10 isoform X1
  KO
K03357  anaphase-promoting complex subunit 10
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100668375 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100668375 (ANAPC10)
   04114 Oocyte meiosis
    100668375 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100668375 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100668375 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100668375 (ANAPC10)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668375 (ANAPC10)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100668375 (ANAPC10)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100668375 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 100668375
NCBI-ProteinID: XP_003417548
UniProt: G3T394
LinkDB
Position
Unknown
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgactacaccaaacaagacacctccaggtgctgaccctaagcagttggaaaggactggg
acagtacgggaaattgggtcacaagctgtttggtcactttcatcttgcaaaccaggattt
ggagtggatcagttacgagatgacaatctggaaacttactggcaatcagatggttcccag
cctcatttagtgaacatccagttcagaagaaaaacaacagtgaagacgttatgtatctat
gcagactacaaatccgatgaaagctatacaccaagcaagatctcggtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgaattggtggaaccaagtggctggatt
catgttcctttaactgataatcacaagaagccaactcgaacattcatgatacagattgct
gttctagccaatcaccaaaatggaagagacacccacatgagacagattaaaatatacaca
ccagtggaagagagttccattggcaaatttcctaggtgtacaactattgatttcatgatg
tatcgttcaataaggtga

KEGG   Loxodonta africana (African savanna elephant): 100669891
Entry
100669891         CDS       T04351                                 

Gene name
ANAPC13
Definition
(RefSeq) anaphase-promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100669891 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100669891 (ANAPC13)
   04114 Oocyte meiosis
    100669891 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100669891 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100669891 (ANAPC13)
   03036 Chromosome and associated proteins [BR:lav03036]
    100669891 (ANAPC13)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100669891 (ANAPC13)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100669891 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 100669891
NCBI-ProteinID: XP_003420037
UniProt: G3SST0
LinkDB
Position
Unknown
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPVGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagcgaggtacagagagatggaaggatcttggatttgattgacgatgcgtggcga
gaagacaagctgccctatgaggatgtggcgatacctctgaatgagcttcccgaacctgaa
caagacaatggtggcaccacagaatctgttaaagaacaagaaatgaagtggacagactta
gccttacagtacctccatgagaacgttccacccgtcggaaactga

KEGG   Loxodonta africana (African savanna elephant): 100670672
Entry
100670672         CDS       T04351                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100670672 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100670672 (CDC23)
   04114 Oocyte meiosis
    100670672 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100670672 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100670672 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100670672 (CDC23)
   03036 Chromosome and associated proteins [BR:lav03036]
    100670672 (CDC23)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100670672 (CDC23)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100670672 (CDC23)
SSDB
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_16 TPR_7 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Other DBs
NCBI-GeneID: 100670672
NCBI-ProteinID: XP_003404567
UniProt: G3SW77
LinkDB
Position
Unknown
AA seq 597 aa
MAAVGSVVPGAVTAAVVPVLTASGDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPPLPLAELQPPPPITEEDAQDMDAYTLAKSYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASACAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEMPAPFFLPASLSANTTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcggtcggttctgtagtcccaggggctgtgacggctgccgtggtgcctgtcctg
acagcgagcggtgatttctcagatttgcgggaaattaaaaagcagctgttacttattgcg
ggccttactcgggagcggggcctactgcacagtagcaaatggtctgcggagttggctttc
tccctacccccgttgcctttggccgagctgcagccgccgccacctattacagaggaagat
gcccaggatatggatgcctacaccctggccaagtcctactttgatgttaaagaatatgat
cgagcagcacatttcctacatggctgcaatagcaagaaggcctatttcctatacatgtat
tccagatacctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggtccc
ctggagaaaggacaagtaaaaaacgaggctcttagagaactcagagtggagctcagcaaa
aaacaccaggctcgggaacttgatggatttggcctttatttgtatggtgtggtgcttcga
aaactggatttggtgaaagaggccattgatgtttttgtggaggctactcatgttttgcct
ttgcactggggagcctggctagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaagaggccctgcagaagtaccagaatctcattgatgtgggtttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatattagagatatcgac
aaagccctctctatttttaatgagctaaggaaacaagatccttacagaattgaaaatatg
gacacattctccaaccttctttatgtccggagtatgaaatcggagttgagttatttggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tatagtttgcgttctcagcatgagaaagcagccttgtatttccagagagccctgaagttg
aatcctcggtatcttggggcctggacactgatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaataagcgggactacaga
gcctggtatggccttgggcagacctatgaaatcctcaagatgccattttactgcctttat
tattatagacgggcccatcagctccggcccaatgattctcgaatgttggttgctttagga
gaatgttatgagaaactcaatcaactagtggaagctaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgctacatcaaatatatccaggatatctattcctgt
ggggaaatagtggaacacttggaggagagcactgctttccgttatctggcccagtactac
tttaagtgcaagctgtgggatgaagcttcagcttgtgcccaaaaatgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccgacaaatcctgcagcttcggaaccaaggc
gagactcccactactgagatgcctgctccctttttcctccctgcttcactgtctgccaat
accacccctacacgcagagtttctccactaaacctttcttcagtcacaccatag

KEGG   Loxodonta africana (African savanna elephant): 100674745
Entry
100674745         CDS       T04351                                 

Gene name
ANAPC11
Definition
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100674745 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100674745 (ANAPC11)
   04114 Oocyte meiosis
    100674745 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100674745 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100674745 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100674745 (ANAPC11)
   03036 Chromosome and associated proteins [BR:lav03036]
    100674745 (ANAPC11)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     100674745 (ANAPC11)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100674745 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 100674745
NCBI-ProteinID: XP_003417372
UniProt: G3U1E4
LinkDB
Position
Unknown
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagatcaagtgctggaatggtgtggccacttggctctgggtggccaatgat
gagaactgtggcatctgccggatggccttcaacggctgctgcccagactgtaaggtgccg
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcactgcatc
ctcaagtggctgaacgctcagcaggtgcagcagcactgccccatgtgccgccaggagtgg
aagttcaaggaatga

KEGG   Loxodonta africana (African savanna elephant): 100676448
Entry
100676448         CDS       T04351                                 

Gene name
ANAPC1
Definition
(RefSeq) anaphase-promoting complex subunit 1 isoform X1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100676448 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100676448 (ANAPC1)
   04114 Oocyte meiosis
    100676448 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100676448 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100676448 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100676448 (ANAPC1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100676448 (ANAPC1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100676448 (ANAPC1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100676448 (ANAPC1)
SSDB
Motif
Pfam: APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 100676448
NCBI-ProteinID: XP_003417450
LinkDB
Position
Unknown
AA seq 1944 aa
MSNVYEERATMIAARDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEEVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSNDEVEKCICILQSSCINMHSIEGKDYIASLPFQVANV
WPTKYGLLFERSSSSHEMPPVPPRKPLPTLFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDTVQGLHSVWVLRRVKPEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVTSPFQNYSSIHSQSRSASSPSLHSRSPSISNMAALSRAHSPALGV
HSFSGVQRFNLSSHNQSPKRHSISHSPNSTSNDSFFAPETEPIVPELCIDHLWTETITNT
REKNSQASKVFITSDVCGQKFLCFLVESQLQLRCVKFQESNDKAQLIFGSVTNIQAKDAA
PVEKIDTMLVLEGSGNLVLYTGIVRVGKVFIPGLPAPSLSMSNTMPRPSTPLDSISTPKP
LSKLLGSMEEVVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSVRDPVHNRVTLELS
NGSMVRIAIPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYNVHSAPGGPSYNSEWNLF
VTCLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDDDWEYLLNSDYHQNVE
SHLLTRSLCLSSLEASEMKDEEFSQNLSLDSSTLLFVHIPAIFFVLHLVYEELKLNTLMG
EGIRSLVDLLVQLARDLKLGPYVDHYYRDYPTLVRTTGQVCTIDQGQTGFMHHPSFFTPE
PPSIYQWVSSRLKGEAIPPYPYLPGICERSKLVVLSMALYILGDEGSVSDEASQYLSRIT
IATQKSQAEQEENRCSFKHSASVSSLAERLVVWMTNVGFTLRDLETLPFGIALPIRDAIY
HCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDMN
QEVMSLIWSEDLRVQDVRRLLQSAHPVRVNVVQYPELSDHEFIEEKENRLLQLCQRTMAL
PVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLNSGNIDVPPNMTSWASFHNG
VAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKG
HEMTSIGLLLGVSAAKLGTMDMSITRLLSIHIPALLPPTSTELDVPHNVQVAAVVGIGLV
YQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLIGMSDLN
VPEQLYQYMVGGHRRFQAGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTNN
RSIADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDILPNSKWVDSNVPQIIRENSIS
LSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYLS
APNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHHM
ALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLLV
PVDVDTDTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIKVKGPRYWELLIDL
SKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLFAQTVANRNSEARAFKPETISA
FTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYIAMDQAIRRL
GRKEMSETSELWQIRLVLEFFSSRSHQERLQNHLNRGLFMNSEFLPVVKCTIDNALDRWL
QAEGDTCVQAYLSGQPFEESQLSMLACFLVYHSVPAPRHLPSIGLEGSTSFADLLFKFKQ
LKMPVRTLLRLAPLLLGSPQPMIM
NT seq 5835 nt   +upstreamnt  +downstreamnt
atgtcgaacgtctatgaagaaagggcaacgatgattgcagccagggatttgcaggaattt
gtcccttttggtcgagaccactgcaagcaccatcccaatgctttgaaccttcagcttcgc
cagctgcagccagcctctgagctatggtcctctgatggtgctgctggcttggtgggatcc
cttcaggaggtcacaatccacgagaaacagaaggaaagctggcagttaaggaagggcgta
agtgaaattggcgaagaagtggactatgatgaggagctgtatgtggctggaaatatggtg
atctggagcaaaggaagtaaaagccaggcactagctgtatataaagcatttacagttgac
agccctgtccagcaggcattgtggtgtgacttcattatatcacaggataagtctgaaaag
gcctacagtaatgatgaagtggaaaaatgcatatgcatattgcaaagctcatgtattaac
atgcatagcatagaaggaaaggattacatagcttctttaccttttcaggttgcaaatgtt
tggcccaccaagtatggactgttgtttgaacggagcagttcttcccatgagatgcctcca
gttcctcccagaaaacctttacccactctgttcagcatgctgcacccactagatgaaata
acaccacttgtttgtaaatctggaagtctttttggttcatcacgggtgcaatatgttgta
gatcatgcaatgaaaattgttttcctcaatactgacccctccattgtgatgacatatgac
accgttcaaggtttgcattctgtgtgggttctccggagagtcaaaccagaggaagagaat
gttgttttaaagttctccgaacaggggggaaccccgcagaatgtggccaccagcagctcc
ctcacggctcacctcagaagcctctccaaaggagattctcccgtgacttcacctttccag
aattattcctccatccacagtcagagccgctcagcctcatcacccagtctacactctcgt
tcaccttctatttccaacatggcagctctcagtcgtgcccattctcctgccttaggagtg
cactctttttcaggggtgcagaggttcaacctttcaagtcataatcagtctccgaaaaga
cacagtatttcccattctccaaatagtacttctaatgactccttttttgcgccagaaaca
gagccaattgttcctgaactttgtattgaccatttatggacagaaacgattactaataca
agagagaaaaattcacaggcttcaaaagtgttcattacgtctgacgtatgtgggcaaaag
ttcttgtgctttttagtagagtcccagctccagttacgctgtgtgaagtttcaagagagt
aatgataaagcccagctcatctttggctctgtcaccaacatacaggcaaaggatgcagca
ccagtggagaaaatagacaccatgctggtcctggaaggcagtggaaacctggtgctatac
acaggaatagttcgggtgggaaaggtttttattcctggactgccagctccttccttgtca
atgtccaatacgatgcctcggcccagtactccacttgacagtattagtactcctaagcct
cttagtaagctactgggatccatggaggaggttgttctgttgtctccagttccagaacta
agggattcctcaaagcttcatgattctctctataatgaagattgtactttccagcagctt
ggaacttacattcattctgtaagggaccctgtccataacagagtaactttagaactgagt
aatggctccatggttaggattgctattcctgaaattgccacctctgaattagtacaaacg
tgtttgcaagcaattaagtttatcctgccaaaagaaatagcagttcagatgcttgtcaag
tggtacaatgtccacagcgctccaggaggacccagttataactcagagtggaatttattt
gtgacttgtctaatgaacatgatgggttataacacagaccgcttagcatggacccgaaat
tttgactttgaaggatcactttccccagtcattgcacccaagaaagcaaggccttctgag
actggatctgatgatgactgggagtatttactaaattcagactaccaccagaatgttgag
tctcatcttttgactagatctttatgtttgagttctttggaagcctcagagatgaaggat
gaggaattttcacagaacttaagcctggattcttctacacttctctttgttcacatacct
gcaattttttttgttcttcatcttgtctatgaggagcttaagttgaatactttaatggga
gaagggattcgttcacttgttgaccttcttgttcagctggcaagggacttaaagttgggg
ccttatgtagatcattactatagagactacccaacgcttgtcagaactactggacaagtg
tgcacaattgatcaaggtcagacaggatttatgcatcatccatcattttttactcctgag
ccgccaagtatttatcagtgggtgagttctcgtctgaagggtgaagcaataccaccctat
ccttacctccctggaatctgtgaaagaagtaaacttgtagtcttgagcatggcactctac
atacttggtgatgagggctctgtttctgatgaagcctcacagtatttatccagaataact
atagccacccaaaagtcacaggcagaacaagaggaaaacagatgtagttttaagcattct
gcatcagtttctagcctagctgaaaggctagttgtctggatgactaatgtaggattcacc
ttaagagatttggagactcttccctttggaattgcacttcccatcagagatgcaatttat
cactgccgtgagcagcctgcttctgactggccagaagctgtctgtctcttgattggacgt
caggacctttccaagcaggcctgtgaaggaaacttacccaaagggaaatctgtgctctca
tcagatgttccttcaggaacagaaactgaggaagaagatgatggcatgaatgacatgaac
caggaggttatgtcattaatatggagtgaagatttaagggtgcaggacgtgcgaagactt
cttcaaagtgcgcatcctgtccgcgtcaatgtagtgcagtacccagagctcagtgaccac
gagttcattgaagaaaaagaaaacagattgctccagttgtgtcagcgaactatggccctc
ccagtgggaagagggatgtttaccttgttttcataccatccggttccaacagaaccattg
cctattcctaaattgaatcttactggacgggcccctcctcggaacacaacagtggacctt
aacagtggaaacattgatgtacctcccaacatgacaagctgggcaagcttccataatggt
gtggctgctggcctgaagatagcccctgcctcccagattgactcggcttggattgtttac
aataagcccaagcatgctgagttagccaatgaatatgctggctttctcatggccctgggt
ctgaatgggcatcttaccaagctggccactctcaacattcatgactacttgaccaagggc
catgaaatgacaagcattggactgctacttggtgtttctgctgctaaactaggcaccatg
gatatgtcaataactcgacttcttagcattcacattcctgctctcctacccccaacttcc
acagaacttgatgtccctcacaatgtccaggtggctgcagtcgttggcatcggccttgtg
tatcaagggacagctcacaggcatactgcagaagtcctgttggctgaaataggacgaccc
cctggtcctgaaatggaatactgcactgacagagagtcatactctttagctgctggcttg
gccctgggcatggtttgcttggggcacggcagtaatttgataggtatgtctgatctcaat
gtgcctgagcagctttatcagtacatggttggaggtcataggcgctttcaagcaggaatg
cacagggagaaacataaatctccaagctaccaaatcaaagaaggagataccataaatgtg
gatgtgacttgtccaggtgccactctggctttggctatgatctacttaaaaaccaataac
agatccattgcagattggctccgagctcccgacaccatgtatttgttggactttgtgaaa
ccggaatttctcttgcttaggacacttgctcgatgcctgattttgtgggatgatatttta
ccaaattccaaatgggttgatagcaacgttcctcagattatcagagaaaatagtatctct
ctcagtgaaattgaattaccttgctctgaggatttgaatttggaaactttgtcgcaagca
catgtctacataattgccggggcctgtttgtctctgggttttcgatttgctggctcagaa
aacttatcagcatttaactgtttgcataaatttgcaaaagattttatgacttatttgtct
gcacctaacgcttctgtaacaggtccttacaacctagaaacatgcttgagtgtggtgctg
ctgtctcttgccatggtaatggctggctcagggaatctaaaggttttgcagctttgtcgc
ttcttgcacatgaaaacaggtggcgaaatgaactatggtttccacttagcccaccacatg
gcccttgggcttctgtttttgggaggaggaaggtactctttgagcacatcaaactcctcc
attgctgccctgctctgtgctctttacccacacttcccagctcatagcactgacaaccgg
tatcatctccaggctctccggcacctgtatgtcctggctgcagaaccaaggcttctagtg
cctgtggatgtggatacagacactccctgctatgccctcttagaagttacctacaagggt
actcagtggtatgaacaaaccaaagaagaattgatggctcctacccttcttccagaactc
caccttttaaagcagattaaagtaaaaggcccaagatactgggaactactcatagattta
agcaagggaacacagcacttgaaatcaatcctttccaaggatggggttttatatgttaag
ctcagggctggtcagctctcctacaaggaagatccaatggggtggcaaagtttatttgcc
cagactgttgctaacaggaactctgaagctcgggctttcaagccagaaactatttcagca
ttcacttctgacccagcactactgtcatttgctgaatatttctgcaaaccaactgtgaac
atgggccagaaacaggaaattctggatctcttttcttcagtactctatgagtgtgttact
caggagaccccggagatgttgcctgcatacatagctatggatcaggctataagaagacta
ggaagaaaagaaatgtctgagacatctgaactttggcagataaggttggtgctagagttt
ttcagctccagaagccatcaggaacgactgcagaaccacctcaaccgagggctcttcatg
aactctgaatttctccccgttgtgaagtgcactattgataatgctctggaccggtggctg
caagctgagggtgatacgtgtgtacaagcctatctcagtggacagccctttgaagaatct
cagctgagcatgctggcttgtttcctcgtctaccactcagtgccagctccacggcacctg
ccatctattggactagaagggagcacaagctttgctgatttactcttcaaatttaaacag
ctgaaaatgccagtgcgaactttgctaagactggctcctttgcttcttggaagcccacag
ccgatgattatgtga

KEGG   Loxodonta africana (African savanna elephant): 100677309
Entry
100677309         CDS       T04351                                 

Gene name
ANAPC5
Definition
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04120  Ubiquitin mediated proteolysis
lav04657  IL-17 signaling pathway
lav04914  Progesterone-mediated oocyte maturation
lav05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100677309 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100677309 (ANAPC5)
   04114 Oocyte meiosis
    100677309 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100677309 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100677309 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100677309 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100677309 (ANAPC5)
   03036 Chromosome and associated proteins [BR:lav03036]
    100677309 (ANAPC5)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100677309 (ANAPC5)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100677309 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_2 TPR_19 VP4_haemagglut TPR_7
Other DBs
NCBI-GeneID: 100677309
NCBI-ProteinID: XP_003420345
LinkDB
Position
Unknown
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGDGAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDTDMELTNR
EESERKMEKEELDVSVREEEVSCSGPLSQKQAEVFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSCVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLESLNAGVQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMNDGKYHLADSLVAGITALNS
IEGVYRKAVVLQAQNQMSEAHRLLQKLLIHCQKVKNTEMVISVLLSVAELYWRSSSPTIA
LPVLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHIAIEPILADGAVLDK
GRAMFLVAKCQVASAASYDPPKKVEALEAAIENLNEAKSYFAKVDCKEQIRDVVYYQARL
YHTLGKTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagtgttcacgagagcctctatttcaaccccatgatgaccaacggggtggtgcat
gccaacgtgttcggcatcaaggactgggtgacgccgtacaagatcgcggtgctggtgctg
ctgaacgagatgggccgcacgggcgacggcgccgtcagcctgatggagcggcggaggctc
aaccagctgctcctgccgctgctgcagggccctgatattacactgtcaaaactatacaag
ttaattgaagaatcttgtcctcagctggcaaattcggtacagatcagaatcaaactgatg
gctgaaggtgaattaaaggatatggaacagttttttgatgacctttcagattctttttct
ggaactgaaccagaggttcacaaaacaagcgttgtaggtttatttctacgtcacatgatc
ctggcctacagtaagctttctttcagtcaagtgtttaaactgtacactgcccttcaacag
tactttcaaaatggtgagaaaaagacagtggaagatactgacatggaactgacaaatagg
gaggagagtgaaagaaaaatggaaaaagaggagctggatgtctctgtcagagaagaagaa
gtatcttgcagtgggcccctgtcccaaaagcaagcagaggtttttctttctcaacaggct
tctttgttaaagaatgatgagactaaagccctcacgccagcttctttgcagaaagaattg
aacaacttgttgaaatttaaccctgattttgccgaagcgcattatctcagctacttgaac
aatctccgggtccaagatgttttcagttcaacacacagcctccttcattattttgaccgc
ctgattcttaccggagctgagagcaaaagtaatggggaagagggctacggccggagcttg
agatacgcagcactgaacctggccgccctgcactgccgcttcggtcactatcagcaggcc
gagctcgccctccaggaggccatcaggattgcccaggagtccaacgatcatgtgtgtctg
cagcattgcttgagctggctttacgtgctggggcagaagagatctgacagctgtgttctg
ctggagcactctgtgaagaaggcagtgcattttgggttaccgtacctcgcgtccctggga
atacagtccctggtgcagcagagagcttttgctgggaagacggcaaacaagctgatggac
gccttgaaggactccgacctcctgcactggaagcacagcctgtcggagctcatcgacatc
agcattgcccagaaaacggccatctggaggctctacggccgcagcaccatggcccttcag
caagcccagatgctgctcagcatgaacagcctggagtcgctaaacgccggcgtgcagcag
aacaacaccgagtcctttgctgtcgcactctgccaccttgcggagctacacgctgagcag
ggttgtttcgctgcagcttctgaagtgttaaagcatttgaaggaacgattcccacccaac
agtcagcacgcccagttatggatgctatgtgatcagaaaatccagtttgacagagcaatg
aatgatggcaaataccacttggctgactcacttgtggcaggaatcacagctcttaatagc
atagagggcgtatatagaaaggcagttgtactacaagctcagaaccaaatgtcggaggca
cacaggctcttacagaagctgttgatccattgtcagaaggtgaaaaacacagagatggtg
atcagcgtcctgctttcagtggccgagctgtactggcgatcctcatcccccaccatcgcg
ctgcccgtgctcctgcaggctctggccctctccaaggagtaccggctgcagtacttggcc
tccgaaacagtgttgaacttggctttcgctcagctcatccttggaatcccagaacaggct
ttgagtcttctccacatagccattgaacccatcctggccgacggggcagtcctggacaaa
ggccgcgccatgttcttggtggccaagtgccaggtggcttcggcagcttcctacgatcca
ccaaagaaagtagaagctctggaggccgccatcgagaacctcaacgaagccaagagctac
tttgcaaaggtcgactgcaaagagcagatccgagatgtggtttactaccaggccaggctc
taccacacgttggggaagacccaggagaggaaccgttgtgcgatgctcttccggcagctg
caccaggagctgccctctcacggggtgcccttgatcaaccatctctag

DBGET integrated database retrieval system