KEGG   Loxodonta africana (African savanna elephant): 100654164
Entry
100654164         CDS       T04351                                 

Gene name
TJP1
Definition
(RefSeq) tight junction protein ZO-1 isoform X1
  KO
K05701  tight junction protein 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04520  Adherens junction
lav04530  Tight junction
lav04540  Gap junction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100654164 (TJP1)
   04530 Tight junction
    100654164 (TJP1)
   04540 Gap junction
    100654164 (TJP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100654164 (TJP1)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100654164 (TJP1)
SSDB
Motif
Pfam: PDZ ZU5 PDZ_6 PDZ_2 Guanylate_kin SH3_2 SH3_1 RPOL_N
Other DBs
NCBI-GeneID: 100654164
NCBI-ProteinID: XP_010598461
LinkDB
Position
Unknown
AA seq 1758 aa
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKIQIPVARSDPEPVSDHEEDSY
DEEVRDPRSVRSGQVNRRNEKSWTRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKS
RKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERS
KGKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSNRSHDRPPRRSR
SRSPDQRSEPSDHSRHSPQQPSNGSLRSREEERTPKPGAVSTPVKHVDDHTPKTVEEVTV
ERNEKQAPTLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSAHEDGILRPSMKLVKFRKGDS
VGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPK
GEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNG
KLGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKR
NLRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIA
KSEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDS
KQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQ
QQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGA
YTDQELDETLNDEVGTPPESAITRSSEPVREDSSGLHPENQTYPPYSPQAQPQPIHRIDS
PGFKTASQQTAEASSPVPYLSPETNPASSTSAVNHSVHLTNVQLEEPTPAPSASPSPQAD
SLRTPSTEAAHIMLRDQEAPLSSHVDPAKAYRKDPYPEEIMRQNHVLKQSAVGHPGPRPD
KETNLSYEPQLPYVEKQASRDLEQPPYRYDTSSYTDQFSRNYDHRLRYEDRVPTYEEQWS
YYDDKQPYQPRPSFDNQHPRDLDSRQHPEESAERGYFPRFEEPAPLSYDSRPRYEQPPRT
PTLRHEEQPTPGYDVHGRYRPEAQPYPSAGPKSSEPKQYFDQYPRSYEQVPSQGFTSKAG
QYEPLHGAAIVPPLMPSSQHKPEVPPQNTKPLPPPPALTEEEEDPAMKPQSVLTRVKMFE
NKRSASLESKKDVNDTASFKPPEVASKPAGPPIIGPKSTPQNQFSEHDKTLYRIPEPQKP
QPKLPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFESKPSAHIPAGHLPEPAKPVHSQSQ
PNFSSYSSKGKPTEADAADRSFGEKRYDPAQTPPPPPLPSQYSQPAQPATSASLALHTHS
KGAHGEGNSVSLDFQNSVVSKPDPPPSQNKPATFRPSNREDTVQTTFFPPKSFPDKAPVN
GAEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKAPTSP
KTVLKAHSSSAQPPEFDSGVETFSIHAEKPKYQIHSTSTVPQAVPVSPSAVEEDEDEDGH
TVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGIEQEIYFKVCRDNSILPPLDKEKG
ETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSNSSSGDPKTWQNKCLPG
DPNYLVGANCVSVLIDHF
NT seq 5277 nt   +upstreamnt  +downstreamnt
atggaggaaacagctatatgggaacaacacacagtgacgcttcacagggcgcctggattt
ggatttggaattgcaatatctggtggaagagataatcctcattttcagagtggggaaacc
tcaatagtaatttcagatgtgctgaaaggaggaccagctgaaggccagttacaggaaaat
gatcgcgtagcgatggttaatggcgtttcaatggacaatgttgaacatgcttttgctgtt
cagcaattaaggaaaagtgggaaaaatgcaaaaattaccattcgaaggaagaagaaaatt
caaataccagtagctcgttccgatcctgagccagtatctgaccatgaagaagatagttat
gatgaagaagtacgtgacccaagaagtgttcgcagtggccaggtcaacagaaggaatgag
aagagttggacaagggatagaagtgcaagtagagagaggagtttgtctccacgatcagat
aggcggtctgtggcttctagtcaacctgctaaacccactaaagttacattggtgaaatcc
cggaaaaatgaagaatatggtcttcgattggccagccatatatttgtaaaggaaatttca
caagatagtttggcagcaagagatggcaatattcaagaaggcgatgttgtattgaagata
aatggtactgtgacagaaaatatgtcattgacagatgcaaagacattgatagaaagatct
aaaggcaagttgaaaatggtagttcaaagagatgaacgggctaccctactgaacgtccct
gatctttctgacagtatccactctgctaacgcctctgagcgagatgacatttcagaaatt
cagtcactggcatcagatcattccaatagatcacacgacaggcccccccgccgcagccgg
tcacgatctcctgaccaaaggtcagagccttctgatcattccagacattctccacagcag
cccagcaacggcagtctgcggagcagagaggaagagagaactcctaagcctggggctgtc
tcgactcctgtaaagcatgtagacgatcacacacctaaaacagtagaagaagttacagtt
gaaagaaatgaaaaacaagcacccactcttccagaaccaaaacctgtgtatgctcaagtg
ggacagccagacgtggatttgcctgtcagcccatctgacggtgtcctcccaaactcagct
catgaagacgggattcttcggcccagtatgaaattggtaaaattcagaaaaggagatagt
gtgggtttgcggctggctggtggaaatgatgtcggaatatttgtggctggagttctagaa
gatagccctgcagcgaaagaaggcctagaagaaggtgatcaaattctcagggtaaacaat
gtagatttcacaaacatcataagagaagaagctgttcttttcctcctcgacctccctaaa
ggagaagaagtgaccatattggctcagaagaagaaggacgtttatcgtcgcattgtagaa
tcagatgtaggagattctttctatattagaacccattttgaatatgaaaaggaatctccc
tacggacttagttttaacaaaggagaagtgttccgtgtcgtggataccttgtacaacgga
aaactgggctcctggcttgctattcgaattggcaaaaatcataaggaagtagaacgaggc
atcatccctaataagaacagagctgagcagttagccagtgtacagtacacacttccaaaa
acagcaggaggagaccgtgctgacttctggagattccgaggtcttcgcagctccaagaga
aatcttcgaaaaagcagagaggatttgtctgcccagccagttcagacaaagtttccagct
tatgaaagagttgttcttcgagaagctggatttctgagacctgtaaccatctttggacca
atagctgatgttgccagagaaaaactggcaagagaagaaccagatatttatcagattgca
aaaagtgaaccacgagatgctggaactgaccaacgtagctcaggcattattcgccttcat
acaataaagcaaataattgatcaagacaagcacgctttattagatgtaacaccaaatgca
gttgaccgtttgaattatgcccagtggtacccaatagtcgtgttccttaaccctgattct
aagcaaggtgtgaaaacgatgagaatgagattatgtccagagtcacggaaaagtgccagg
aagttatatgagcggtctcataaacttcgtaaaaataatcatcatctttttacaactaca
attaatttaaattcaatgaatgatggttggtatggtgcactaaaagaagcaattcagcaa
caacagaaccagctggtatgggtttctgagggaaaggcggatggtgctacaagtgatgac
cttgatttgcatgacgatcgtctgtcctacctgtcagccccaggtagcgaatactcaatg
tatagcacggacagtagacacacttctgactatgaagacacagatacagaaggcggggcc
tacactgatcaagaactagatgaaacccttaatgatgaggttgggactccaccggagtct
gccattacacggtcctctgagcctgtaagagaggactcctctggactgcatcctgaaaac
caaacatatcctccttactcaccacaagcgcagccacaaccaattcatagaatagactcc
cctggatttaaaacagcctctcaacagacagcagaagcctcatctccagtcccttacctt
tcgcctgaaacaaacccagcatcatcaacctcagctgttaatcacagtgtgcatttaact
aatgtacaactggaggagcccaccccagctccttccgcctctccctcaccacaagctgat
tctttaagaacaccaagcactgaggcagctcacataatgctcagggatcaagaagcacca
ttgtcgtcgcatgtagacccagcaaaggcgtatagaaaggatccatatcctgaggaaata
atgagacagaatcatgttttgaagcagtcagctgttggtcacccagggccaagaccagac
aaagagactaatctgagctatgagccccagctcccctatgtagagaaacaagccagcaga
gacctggagcagcccccgtacagatatgacacctcgagctacacggaccagttttctcga
aactatgaccatcgtctgcggtatgaagatcgagtccctacatatgaagaacagtggtca
tattatgatgacaaacagccctaccaacctcgaccttcttttgataatcagcatcctcga
gaccttgactccagacagcatcctgaagagtccgcagaacgagggtattttccacgtttt
gaagaaccggctcctctgtcttacgacagtaggccacgctatgaacagccacctagaact
cctaccctccgacatgaagagcagccaactcctgggtatgacgtgcatggcaggtacaga
ccagaagcacagccctatccttcagcaggccctaagtcttcagagcccaagcagtatttt
gaccagtacccacgaagttacgagcaagtaccatcgcaaggatttacctccaaagcaggc
cagtatgagcctctccatggtgctgcaattgtccctcctctaatgccttcatcccaacat
aagccagaagttccgcctcaaaataccaaaccgctgcctccacccccagctctgactgaa
gaagaggaagatccagcaatgaaaccacagtctgtgctcactagggttaaaatgtttgaa
aacaagaggtccgcatcgttagagagtaagaaggacgtaaacgacacagccagctttaag
cctccagaagtagcatcgaaacctgcggggcctcccatcattggtcctaagtccactccg
cagaatcaattcagtgagcatgacaaaacactctacaggatcccagagcctcagaaacct
cagccgaagctgcctgaagatattgttcgttcaaatcattacgaccctgaggaagatgag
gaatattatcgaaaacagctctcatactttgaccgaagaagttttgagagcaaaccctct
gcacacattcctgctggccatctcccagagcctgccaagcctgttcattctcagagtcaa
ccaaatttctctagttactcttccaagggaaagcctactgaagctgatgctgcggatagg
tcatttggggagaaacgatacgacccagcccagacccctcctcctcctccactgccctcc
cagtacagccagcctgctcagcctgccaccagcgcttctctggccctccacacacattcc
aagggagcccatggggaaggtaattcagtgtcattggattttcagaattctgtagtgtca
aaaccagacccacctccatcgcagaataagccagcaactttcagaccatcaaacagagaa
gatactgttcagactactttctttcccccgaaaagtttcccagataaagctccagttaat
ggagctgaacagactcagaaaacagtcactccagcatacaatcgattcacaccaaaacct
tatacgagttctgctaggccgtttgaacgcaagtttgaaagccctaaattcaatcacaat
cttttgccaagtgaaactgcacacaaaccagacttatcttcaaaagcccccacttctcca
aagaccgttctgaaagcacacagttcttcagcacagcctcctgagtttgacagtggagtg
gaaaccttctccatccatgcagaaaagcccaaatatcagatacacagcaccagcacagtg
cctcaagctgttcctgtcagcccttcagctgtggaagaggatgaagatgaggacggccat
actgtggtggccacagcccgaggcatatttaacagcaacggtggggtgttgagctccata
gaaactggtgttagtataattatcccgcaaggagccattcccgagggaattgagcaggaa
atctatttcaaggtctgccgagacaacagcatcctcccacctttagataaagagaaaggt
gagacactgctgagccccttagtgatgtgtgggccccatggcctcaagttcctgaaacca
gtggagctgcgcttaccacactgtgcgtccatgactcctgacggttggtcttttgctcta
aaatcatccaactcctcgtcgggtgatcctaaaacctggcagaacaagtgtcttcctgga
gatccaaattaccttgttggagcaaactgtgtttctgtcctgattgaccacttttaa

DBGET integrated database retrieval system