KEGG   Loxodonta africana (African savanna elephant): 100654286
Entry
100654286         CDS       T04351                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05134  Legionellosis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05222  Small cell lung cancer
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100654286
   04215 Apoptosis - multiple species
    100654286
   04115 p53 signaling pathway
    100654286
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654286
  09162 Cancer: specific types
   05210 Colorectal cancer
    100654286
   05222 Small cell lung cancer
    100654286
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100654286
   05012 Parkinson disease
    100654286
   05014 Amyotrophic lateral sclerosis
    100654286
   05016 Huntington disease
    100654286
   05017 Spinocerebellar ataxia
    100654286
   05020 Prion disease
    100654286
   05022 Pathways of neurodegeneration - multiple diseases
    100654286
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100654286
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100654286
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654286
   05134 Legionellosis
    100654286
   05152 Tuberculosis
    100654286
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100654286
   05161 Hepatitis B
    100654286
   05160 Hepatitis C
    100654286
   05164 Influenza A
    100654286
   05162 Measles
    100654286
   05168 Herpes simplex virus 1 infection
    100654286
   05163 Human cytomegalovirus infection
    100654286
   05167 Kaposi sarcoma-associated herpesvirus infection
    100654286
   05169 Epstein-Barr virus infection
    100654286
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100654286
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100654286
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100654286
NCBI-ProteinID: XP_003406247
UniProt: G3UCG1
LinkDB
Position
Unknown
AA seq 104 aa
MGDAEAGKKIFIQNCAQCHRVEKGGRHKTGPNLWGLFGRKTGQAPGFSYTDANKNKGIIW
GEATLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIQYLKKSTS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggagatgccgaagcaggaaagaagatctttattcaaaactgtgctcagtgccacaga
gtggaaaaaggtggaaggcacaagactggcccaaatctctggggcctctttggccgaaaa
acaggacaagcaccaggattttcttacactgatgcaaacaaaaacaaaggtattatctgg
ggagaagcaactctgatggagtatttggagaatccaaagaaatacatccctggaacgaaa
atgatcttcgctggtcttaaaaagaagagtgagagggaagatcttattcaatatttaaaa
aagtcaacatcttaa

KEGG   Loxodonta africana (African savanna elephant): 100657132
Entry
100657132         CDS       T04351                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04932  Non-alcoholic fatty liver disease
lav05010  Alzheimer disease
lav05012  Parkinson disease
lav05014  Amyotrophic lateral sclerosis
lav05016  Huntington disease
lav05017  Spinocerebellar ataxia
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05134  Legionellosis
lav05145  Toxoplasmosis
lav05152  Tuberculosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05164  Influenza A
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05222  Small cell lung cancer
lav05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100657132
   04215 Apoptosis - multiple species
    100657132
   04115 p53 signaling pathway
    100657132
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100657132
  09162 Cancer: specific types
   05210 Colorectal cancer
    100657132
   05222 Small cell lung cancer
    100657132
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100657132
   05012 Parkinson disease
    100657132
   05014 Amyotrophic lateral sclerosis
    100657132
   05016 Huntington disease
    100657132
   05017 Spinocerebellar ataxia
    100657132
   05020 Prion disease
    100657132
   05022 Pathways of neurodegeneration - multiple diseases
    100657132
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100657132
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100657132
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100657132
   05134 Legionellosis
    100657132
   05152 Tuberculosis
    100657132
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100657132
   05161 Hepatitis B
    100657132
   05160 Hepatitis C
    100657132
   05164 Influenza A
    100657132
   05162 Measles
    100657132
   05168 Herpes simplex virus 1 infection
    100657132
   05163 Human cytomegalovirus infection
    100657132
   05167 Kaposi sarcoma-associated herpesvirus infection
    100657132
   05169 Epstein-Barr virus infection
    100657132
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100657132
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100657132
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100657132
NCBI-ProteinID: XP_003407118
UniProt: G3SZ22
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKQATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgtcgagaagggcaagaagatttttgttcagaaatgttcccagtgccacaca
gtggaaaagggaggcaagcacaagactgggccaaatctgcacggcttgtttgggcggaag
actggtcaagcccctggattctcttacacggatgccaataagaacaaaggtatcacctgg
ggagaggacacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagaaggcagaaagggcagacttgatagcttatctcaag
caagctactaatgagtaa

DBGET integrated database retrieval system