KEGG   Loxodonta africana (African savanna elephant): 100654486
Entry
100654486         CDS       T04351                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100654486 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100654486 (PPP2R1A)
   04390 Hippo signaling pathway
    100654486 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    100654486 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    100654486 (PPP2R1A)
   04152 AMPK signaling pathway
    100654486 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100654486 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100654486 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100654486 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100654486 (PPP2R1A)
   04730 Long-term depression
    100654486 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100654486 (PPP2R1A)
   05165 Human papillomavirus infection
    100654486 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100654486 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100654486 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100654486 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:lav03036]
    100654486 (PPP2R1A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100654486 (PPP2R1A)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100654486 (PPP2R1A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100654486 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N M11L TAF6_C Spore_Cse60
Other DBs
NCBI-GeneID: 100654486
NCBI-ProteinID: XP_010584891
UniProt: G3TIN3
LinkDB
Position
Unknown
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAVDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgagctc
cgcaacgaggatgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggtgttgaaaggacccgcagcgagctcctgcccttccttacagacactatctac
gatgaggatgaggtcctcttggccctggcagaacagctgggaaccttcaccaccctggtg
ggaggcccagagtacgtgcactgcctgctgccacccctggagtcgctggccacggtggag
gagacggtggtgcgagacaaggcagtggagtccttgcgggccatctcacacgaacattca
ccgtcggacctggaggcccacttcgtgccgctggtgaagcggctggcgggtggcgactgg
ttcacctcccgcacctccgcctgtggcctcttctctgtctgctacccccgagtgtccagt
gcggtcaaggcagaacttcgacagtacttccggaacctgtgttcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagcgagatcatccccatgttctccaacctagcctctgacgagcaggactcggtg
cggctgctggcagtggaggcgtgcgtgaacattgcccagctcctgccccaggaggacctg
gaggctctggtgatgcccaccctgcgccaggctgctgaggacaagtcctggcgtgtccgc
tacatggtggccgacaagttcaccgagctccagaaagcagtgggccctgagatcaccaag
acggacctggtccctgccttccagaacctgatgaaggactgtgaggccgaggtgagggcc
gccgcctcccacaaggtcaaagagttctgcgaaaatctctctgctgactgccgggagaac
gtgatcatgacccagatcctgccctgcatcaaggagctggtgtcagacgccaaccaacac
gtcaagtcagccctggcctcggtcatcatgggcctgtctcccatcctgggcaaagacaac
accattgagcacctcctgcccctcttcctggcccagctgaaggatgagtgccctgaggtg
cggctgaacatcatctccaacctggactgcgtgaatgaggtgattggcatccggcagctg
tcccagtccctgctccctgccatcgtggagctggccgaggacgccaagtggcgggtgcgg
ctggccatcatcgagtacatgcccctgctggctggacagctgggggtagagttctttgat
gagaagctcaactctttgtgcatggcctggctggtggatcatgtttatgccatccgcgag
gcggccaccagcaacctgaagaagctggtggagaagtttgggaaggaatgggcccacgcc
accatcatccccaaggtcttggccatgtctggggaccccaactacctgcaccgcatgact
acgctcttctgcatcaacgtactgtctgaggtttgtgggcaggacatcaccaccaagcac
atgctgcccaccgtcctgcgaatggctgtggaccctgtcgccaacgtccgcttcaacgtg
gccaagtccctccagaagattgggcccatcctggacaacagcacgctgcagagtgaggtc
aagcccatcctggagaagctgacccaggaccaggatgtagacgtcaagtactttgcccag
gaggctctgactgttctgtctctggcctaa

KEGG   Loxodonta africana (African savanna elephant): 100659875
Entry
100659875         CDS       T04351                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100659875 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100659875 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    100659875 (PPP2R5A)
   04152 AMPK signaling pathway
    100659875 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100659875 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100659875 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100659875 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100659875 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659875 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100659875 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:lav03036]
    100659875 (PPP2R5A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100659875 (PPP2R5A)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100659875 (PPP2R5A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100659875 (PPP2R5A)
SSDB
Motif
Pfam: B56 SBF2 Sec7_N
Other DBs
NCBI-GeneID: 100659875
NCBI-ProteinID: XP_010600050
LinkDB
Position
Unknown
AA seq 402 aa
MDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSENPDFD
PEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYVDQKFVQQLLELFDSEDPRER
DFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPL
KAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLEKDATLTEPVIRGLLKFWPKTCSQ
KEVMFLGEIEEILDVIEPTQFRKIEEPLFKQISKCVSSSHFQVAERALYFWNNEYILSLI
EENIDKILPIMFGSLYKISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAERQRE
KKKELEREELWKKLEELKLKKALEKQNSAYNMHSILSSTSAE
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggactctgtgtcagacttgaagagcaaagaaattaaaagagcaacgctcaatgaactg
gttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcgtattctgatatagta
aaaatgatcagcgctaacatcttccggactctccctccaagtgagaatccggattttgat
ccagaagaagacgagcccacgctcgaggcctcttggcctcacatacaactggtgtatgaa
ttcttcttgagatttctggagagccctgatttccagcccagcattgccaagcgatacgtt
gatcagaaatttgtacagcagctcctggagctttttgatagtgaagaccccagagaacgt
gacttcctgaagactgttctgcatcgaatttacgggaaatttcttggattaagagcattc
atcagaaaacagattaacaacattttcctcaggtttatatatgaaacagaacatttcaat
ggtgttgctgaactccttgaaatattagggagtattatcaatggctttgcgctgccgctg
aaagcagaacataaacagttcctgatgaaggttctcattcctatgcacactgcaaaaggg
ttagctttgtttcatgctcagctcgcctactgcgtggtgcagttcctggagaaagatgca
accctgacagaaccagtgatcagaggattgctaaaattttggccaaaaacatgcagtcag
aaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcattgagccaacacag
ttcagaaaaattgaagagccgctttttaaacagatatcgaagtgcgtatccagctctcat
tttcaggtcgctgagagggctttgtacttctggaataatgaatatattctcagtttaatc
gaggagaacatcgacaaaatcctgccaattatgtttggcagtttgtacaaaatctccaaa
gaacactggaatccgaccattgtagcgctggtatacaatgtgctgaaaacgctaatggag
atgaatggcaagctttttgatgaccttactagctcatacaaagctgaaagacaaagagag
aaaaagaaggaattggaacgtgaagaattatggaaaaagttagaagagctaaagctcaag
aaagctctagaaaagcagaacagtgcttacaacatgcacagtattctcagcagtacaagt
gctgagtaa

KEGG   Loxodonta africana (African savanna elephant): 100659955
Entry
100659955         CDS       T04351                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100659955 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100659955 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    100659955 (PPP2R5D)
   04152 AMPK signaling pathway
    100659955 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100659955 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100659955 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    100659955 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100659955 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100659955 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100659955 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:lav03036]
    100659955 (PPP2R5D)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100659955 (PPP2R5D)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100659955 (PPP2R5D)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100659955 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 100659955
NCBI-ProteinID: XP_003403952
LinkDB
Position
Unknown
AA seq 606 aa
MPYKLKKEKEPPKLAKGTAKPSSSGKDGGGENAEEAQPQPQPQAQSQSQPQSQPQPPSSN
KRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREE
LFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFS
VNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYID
QKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNG
IAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESS
LTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHF
QVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEM
NQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMET
ETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLT
ASQEAL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgccctacaaactgaagaaggagaaggagccccccaagcttgccaaaggcacagccaag
cccagcagctcaggcaaggatggtggaggcgagaacgccgaggaggcacagccacagccg
cagccacaagcccagtcacagtcccagccacagtcccagccccagccaccatcatccaac
aagcgccccagcaacagcacaccgccccccacgcagctcagcaaaatcaaatactcaggg
gggccccagattgtcaaaaaggagcgacggcagagctcctcccgcttcaacctcagcaaa
aaccgggagctgcagaagcttcctgccctgaaagattcgccaacccaggagcgggaggag
ctgttcatccagaagctacgccagtgctgcgtcctctttgactttgtctcagacccactc
agtgacctcaaattcaaggaggtgaaacgggcaggactcaacgagatggtggagtacatc
acccacagccgcgatgttgtcaccgaggctatttacccagaggctgtcaccatgttttct
gtgaacctctttcggacgctgccaccttcatcgaatcccacaggggctgagtttgaccca
gaggaggatgagcccaccctggaggcagcctggccccatctccagctcgtgtatgagttt
ttcttacgtttccttgagtctcctgatttccagccaaacatagccaagaagtacattgac
cagaagtttgtccttgctctcctggacctctttgacagtgaggatcctcgagagcgggat
ttcctcaagaccatcttgcatcgcatctatggcaaatttttggggctccgggcctatatc
cgcaggcagattaatcacatcttctacaggttcatctatgagacggagcaccacaatggg
attgctgagctcctggagatcctgggcagcatcatcaatggctttgccctgccccttaaa
gaagagcacaaaatgttcctcatccgtgtcctgcttccccttcacaaggtcaagtccctg
agtgtctaccatcctcagttggcatactgtgtggtacagttcctggagaaggagagcagt
ctgacagagccggtgattgtgggacttctcaagttctggcccaagacccacagccccaag
gaggtgatgttcctgaatgagctggaggagattctggacgtcattgagccttcagagttc
agcaaagtgatggaaccgctcttccgccagcttgccaagtgtgtctccagcccccatttc
caggtggcagagcgtgctctctattactggaacaatgagtacatcatgagcctgataagt
gacaatgccgcccgggttctccccatcatgttccccgcgctctacaggaactccaagagc
cactggaataagacaatccatggactgatctacaatgcccttaaactgtttatggagatg
aatcagaagctttttgatgactgcacacagcaatacaaggcagagaagcagaagggccgg
ttccgaatgaaggaaagagaagagatgtggcaaaagattgaggagctggcccggctgaat
ccccagtatcccatgttccgagctcctccacctctgccccccgtgtactcgatggaaaca
gagacccccacggcagaggacatccagcttctgaagaggacagtggagacagaggctgtg
cagatgctcaaagacatcaagaaggaaaaagtgctgcttcggcggaagtcagagctgccc
caggatgtgtacaccatcaaggcactggaagcgcataagcgggccgaagagttcctaact
gccagccaggaggcactctga

KEGG   Loxodonta africana (African savanna elephant): 100660424
Entry
100660424         CDS       T04351                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100660424 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100660424 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    100660424 (PPP2R5B)
   04152 AMPK signaling pathway
    100660424 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100660424 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100660424 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100660424 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100660424 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100660424 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100660424 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:lav03036]
    100660424 (PPP2R5B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100660424 (PPP2R5B)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100660424 (PPP2R5B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100660424 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 100660424
NCBI-ProteinID: XP_010597474
LinkDB
Position
Unknown
AA seq 457 aa
SGPSGGRTPLPRAAQLGPWLSTPRSPDVPASELHELLSRKLAQCGVVFDFLDCVADLKGK
EVKRAALNELVECVGSTRGVLIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEP
SWPHLQLVYEFFLRFLESPDFQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRV
YGKFLGLRAYIRKQCNHIFLRFIYEIEHFNGVAELLEILGSIINGFALPLKTEHKQFLVR
VLIPLHSVKSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEME
EILDVIEPSQFVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPA
VFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKARERQEL
WQGLEELRLRRLQGTQGAKEAPLQRLTPQVAASGGQS
NT seq 1374 nt   +upstreamnt  +downstreamnt
agtggccctagcggtgggaggacccccttacccagagctgcgcagctagggccttggctt
agcacccctcgctccccagatgtgccggcctcggagctgcacgagttgctcagccgcaag
ctggcccagtgcggggtggtgtttgacttcctggactgtgtggctgacctgaagggaaag
gaggtaaagcgggcggccctcaacgagctggtggagtgcgtggggagcacacggggcgtc
ctcatcgagcctgtgtacccagacatcatccgcatgatctcagtgaatatcttccggacc
ttgccgcccagtgaaaaccctgaatttgaccctgaagaggatgagcccaacctcgagcct
tcgtggccacatctgcagctggtttatgagtttttcctgcgtttcctggagagcccagat
tttcagccctctgtggccaagagatatgtggatcagaagtttgtcttgatgctcctggag
ctgtttgatagcgaggacccgcgggagcgtgagtacctgaagaccatcctgcaccgggtc
tatggcaagttcctggggctgcgggcctacatccgcaaacaatgcaaccacatcttcctg
cggtttatctacgagatcgagcacttcaatggtgtggctgagctgctggagatcctggga
agcatcatcaatggctttgcgctgcccctgaagaccgagcacaagcagttcctggtccgg
gtcctgatccccctgcactctgtcaagtcgctgtctgtctttcacgcccagctggcatac
tgtgtggttcagttcctagagaaggatgccaccctgacagagcacgtgatccgggggttg
ctcaagtattggcccaaaacctgcacccagaaggaggtgatgtttctgggggagatggaa
gagattctcgatgtcattgagccctcccagttcgtgaagatccaggagcccctcttcaag
caggtggctcgctgtgtctccagcccccatttccaggttgcagagcgggctctgtacttc
tggaacaacgagtatatcctgagcctcattgaggacaactgccacactgtgctgcctgct
gtgtttgggaccctctaccaggtctccaaggagcactggaatcaaaccatcgtctctctg
atctacaatgtactcaagaccttcatggaaatgaatgggaaactattcgatgagctcaca
gcctcctacaagctggaaaagcagcaggagcagcagaaggcccgtgagcgccaggagctg
tggcaaggcctggaggagctacggctacgccggttacaggggacccagggggctaaggag
gcccccctccagcggcttacgccccaggtggctgccagtgggggtcagagctag

KEGG   Loxodonta africana (African savanna elephant): 100663532
Entry
100663532         CDS       T04351                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100663532 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100663532 (PPP2R1B)
   04390 Hippo signaling pathway
    100663532 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    100663532 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    100663532 (PPP2R1B)
   04152 AMPK signaling pathway
    100663532 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100663532 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100663532 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663532 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100663532 (PPP2R1B)
   04730 Long-term depression
    100663532 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100663532 (PPP2R1B)
   05165 Human papillomavirus infection
    100663532 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100663532 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100663532 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100663532 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:lav03036]
    100663532 (PPP2R1B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100663532 (PPP2R1B)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100663532 (PPP2R1B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100663532 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N AEP1 DUF3730 IFRD
Other DBs
NCBI-GeneID: 100663532
NCBI-ProteinID: XP_010593752
LinkDB
Position
Unknown
AA seq 615 aa
MAGAAGPGSGSGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASSAIKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELESVKSEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLTQDDLETLVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELCENLPTEGRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTDPEAYLSQILLLNFSALQGEVKLVLQKLGQDEDMD
VKYFAQEAISVLALA
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcgggcgcggcggggcccggtagcggctcgggggcagcgggcggagacggagacgat
tcgctctacccgatcgcggttttaatcgacgagctccgcaatgaggacgtgcagctccgt
cttaacagtattaagaagttatcaacaattgctttagcacttggagtagaaagaactaga
actgaactgctgccattccttactgatacaatctatgatgaagatgaggtactgctagct
cttgctgagcagctgggaaattttactggccttgtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaagtctagcaactgttgaagagactgtggttcgcgacaaggct
gtggagtccctgagacagatctcccaggagcatactcctgttgctctggaagctcatttt
gtacctctggtgaaacgcctagcaagtggggattggttcacttctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcttccagtgccatcaaggcagaaattagacag
catttccgttctctgtgctcagatgacacaccaatggtacgacgtgcggctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagaaagtgtgaaaagtgaaattgttccattg
ttcaccaatctagcttcagatgaacaggactcagtgcgcctcctagctgtggaagcttgt
gtcagtattgcccagttactgacccaggacgaccttgagactttggtgatgcctactctt
cgacaggcagcagaagataaatcttggcgagttcgctatatggttgctgacaaattttca
gagctccagaaagccgtgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctccttaaagactgtgaagctgaagtccgagcagctgctgcccacaaagtaaaagaa
ctttgtgagaacttacccactgaaggtagagagaccataattatgaatcaaattctgccc
tatataaaggaattagtttctgatacaaatcaacatgtcaaatcagctctagcttctgta
attatgggattgtctaccattttgggcaaggagaataccattgagcatcttctacctctt
tttttagctcaattaaaggatgagtgtcctgaagttcgtttgaacatcatctccaatttg
gattgtgtaaatgaagttattggaatccgtcagctctctcagtctcttcttcctgccata
gtggagctggctgaagatgccaagtggagggtccggctggccatcattgagtatatgccc
ctgctggcgggtcagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcctggcttgtggaccatgtgtatgccatccgagaagctgccacaaacaacctcatgaaa
ctagttcagaagtttggtacggagtgggcccaaaataccattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttgttctgcattaatgcactg
tctgaagcctgtggtcaggaaataaccactaagcaaatgctgcccattgtattaaaaatg
gcaggagaccaagtggcaaacgttcgtttcaatgtggccaaatctctacagaaaattgga
ccaattctagatactgacccagaagcctacctttcacagatactgctgttgaatttcagt
gcgttgcagggtgaagttaagctggtactacaaaagttaggccaagatgaagacatggat
gtcaaatattttgctcaggaagctataagtgttcttgcgttggcataa

KEGG   Loxodonta africana (African savanna elephant): 100663566
Entry
100663566         CDS       T04351                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100663566
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100663566
   04151 PI3K-Akt signaling pathway
    100663566
   04152 AMPK signaling pathway
    100663566
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100663566
  09156 Nervous system
   04728 Dopaminergic synapse
    100663566
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100663566
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100663566
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100663566
   03036 Chromosome and associated proteins [BR:lav03036]
    100663566
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100663566
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100663566
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100663566
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_1
Other DBs
NCBI-GeneID: 100663566
NCBI-ProteinID: XP_023397666
LinkDB
Position
Unknown
AA seq 454 aa
MHGAWTCGLQGLCSHLETALLQARSSALSQQRFGHGQLVGTPGPPHAVPLRQAVSLRPTV
DSPCPHASAEGCSCVRVSEQWASSVSSRVLQNCHDDAAKFVHLLMSPGSNYLVQEDFVPF
LQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYTVNRSWSGRITCMELRKSTFLQNVAL
LEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDPDDLARHNDHAISRKMVERIFS
GAVTRGKKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGVLSMYELEYFY
EEQCRRLDNMAIEALPFQDCLCQMLDLVQPEHEGKITLHDLKKCKLANVFFDTFFNIEKY
LDQEQREQVSLLRETESDGPELSAWEKYAAEEYDILVAEEAAGDPWNDGYEPELSPVDPK
LRPQLDTRPFLEASSALGTVDLYEYEGDDGPQLL
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcatggagcttggacgtgcggccttcagggcctatgctctcacttggagaccgctttg
cttcaggcacgttcttctgccctgtcacagcagagatttggccatgggcagcttgtgggt
acacctgggcccccacatgctgtcccactccgccaggctgtctccctgcgccccacggtc
gacagtccctgccctcacgcctctgcagagggctgctcctgtgttcgcgtgtcagagcag
tgggcatcctctgtctcctccagggtcctccagaactgtcacgatgacgccgccaagttt
gtgcacctcctcatgagccctgggagcaactacctggtgcaggaggacttcgtgcccttc
ctccaggacgttgtgaacacgcaccccggcctgtcctttctgaaggaggcgtccgagttc
cattcccgctacatcaccaccgtcatccagcggatattctacaccgtgaaccggtcctgg
tcgggacgaatcacatgcatggagctcaggaagagcaccttcttgcagaacgtggcactc
ctggaggaggaagccgacatcaaccagctaacggagttcttctcctacgagcacttctac
gtcatctattgcaagttctgggagctggacactgaccacgacctactcatcgaccccgac
gacctggcccggcacaacgaccacgccatatccaggaagatggtggagcggatcttctca
ggtgcagtgaccagaggcaagaaggtgcagaaagaggggaagatcagctacgccgacttc
gtctggttcctcatctcagaggaagacaagaagacccccaccagcatcgagtactggttc
cgctgtatggacctggacggggacggggtgctgtccatgtatgagcttgagtacttctac
gaggagcagtgccgccgcctggacaacatggccatcgaggcgctgcccttccaggactgt
ctctgccagatgctcgacctggtgcagcccgagcatgaagggaagatcacccttcacgac
ctgaagaagtgcaaactggcaaacgtgttcttcgacacatttttcaacatcgagaagtac
ctcgaccaggagcagagggagcaggtgtccctgctcagggagactgagagcgacggccca
gagctctctgcctgggagaagtacgctgctgaggagtacgacatcctggtggcagaggag
gctgccggggacccgtggaacgacgggtacgagcccgagctcagccccgtggaccccaag
ctgcgcccacagctggacacgaggcctttcctggaggcgtcatccgcattgggcaccgtg
gacctgtacgagtatgagggcgacgatggcccgcagctgctgtga

KEGG   Loxodonta africana (African savanna elephant): 100664132
Entry
100664132         CDS       T04351                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04136  Autophagy - other
lav04140  Autophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100664132 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100664132 (PPP2CA)
   04390 Hippo signaling pathway
    100664132 (PPP2CA)
   04071 Sphingolipid signaling pathway
    100664132 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    100664132 (PPP2CA)
   04152 AMPK signaling pathway
    100664132 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100664132 (PPP2CA)
   04136 Autophagy - other
    100664132 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100664132 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100664132 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100664132 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    100664132 (PPP2CA)
   04730 Long-term depression
    100664132 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100664132 (PPP2CA)
   05165 Human papillomavirus infection
    100664132 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100664132 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100664132 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100664132 (PPP2CA)
   04131 Membrane trafficking [BR:lav04131]
    100664132 (PPP2CA)
   03036 Chromosome and associated proteins [BR:lav03036]
    100664132 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100664132 (PPP2CA)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100664132 (PPP2CA)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100664132 (PPP2CA)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100664132 (PPP2CA)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100664132 (PPP2CA)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100664132 (PPP2CA)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100664132 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 100664132
NCBI-ProteinID: XP_003404542
UniProt: G3THP9
LinkDB
Position
Unknown
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaagtgttcaccaaggagctagaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaggaggttcgatgtccagtcactgtctgtggagatgtacatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctg
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagataacacaagtatatggtttctatgatgaatgtttaaggaaatatggaaatgcg
aatgtgtggaaatattttacagatctttttgactatctccctctcactgccttggtggat
gggcagatcttctgtctacatggtggcctctcaccatccatagatacactggatcacatc
agagcacttgatcgcctacaagaagttccccatgagggcccaatgtgtgacttgctgtgg
tcagatccagatgaccgaggtggttggggtatatctcctcgaggagctggttacaccttt
ggacaagatatttctgagacatttaatcatgccaatggcctcacgttggtatctagagct
caccagctggtaatggagggttataactggtgccatgaccggaacgtagtaacaattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcgcctcgcagaggcgaaccacatgtt
actcgtcgtactccagactacttcctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100666413
Entry
100666413         CDS       T04351                                 

Gene name
PPP2R2B
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100666413 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100666413 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    100666413 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    100666413 (PPP2R2B)
   04152 AMPK signaling pathway
    100666413 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100666413 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666413 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100666413 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100666413 (PPP2R2B)
   05165 Human papillomavirus infection
    100666413 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100666413 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100666413 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100666413 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:lav03036]
    100666413 (PPP2R2B)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100666413 (PPP2R2B)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100666413 (PPP2R2B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100666413 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 100666413
NCBI-ProteinID: XP_023406136
LinkDB
Position
Unknown
AA seq 543 aa
MHQPPPASSCSSGSCECARVRVSALAPAAAPCPAPRRLSSYRLPEPPSRGTSTLIRARPL
GPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINNSFLRDHSY
ATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEF
DYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLR
DPSTITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWN
FEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDR
HTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQ
VHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRE
NSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQD
KVN
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgcaccagccgcctccagcctcctcctgcagcagcggcagctgcgagtgcgcgcgtgtg
agggtgagtgcgctggcgccggccgcagcgccctgcccagctccccgccggctttctagc
taccgcctgccggagccaccctcccgtgggaccagcactctcatccgggccaggccgctc
ggaccatggtgcagtcccactggctcccctgcccccctctcctgtgagactggctgcggg
gagggatcatggatacttgtctgccggcttctggttcccacgcaagtaagcctgctgtca
atggaggaggacattgatacccgcaaaatcaacaacagtttcctgcgcgaccacagctat
gctaccgaagctgacattatctctacggtagaattcaaccacacgggagaattactagcg
acaggggacaaggggggtcgggttgtaatatttcaacgagagcaggagagtaaaaatcag
gttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaacccgagttc
gattacctgaagagcttagaaatagaagaaaaaatcaataaaataagatggctccctcag
cagaatgcggcctactttcttctgtctactaatgataaaaccgtgaagctgtggaaagtg
agcgagcgcgataagaggccagaaggctacaacctgaaagatgaggagggccggctccgg
gatccttccaccatcacaaccctacgggtgcctgtcctgagacccatggacctgatggtg
gaggccaccccacgaagagtatttgccaacgcgcacacttatcacatcaactccatatca
gtcaacagcgactatgaaacctacatgtcagctgatgacctgaggattaacctatggaac
tttgaaataacgaatcaaagttttaatatcgtcgacattaagccggccaacatggaggag
ctcacagaggtgatcacagcagctgagttccacccccatcactgcaacacctttgtgtac
agcagcagcaaagggacgatccggctgtgtgacatgagggcatcagccctgtgtgacagg
cacactaaattttttgaagagccggaagatccaagcaacaggtcatttttctctgaaatc
atctcttcgatttcagatgtgaagtttagccacagtggaaggtatatcatgaccagggac
tatctgaccgttaaagtctgggatctcaacatggaaaaccgccccatcgagacttaccag
gttcatgactacctccgcagcaagttgtgctccctctacgaaaatgactgcatttttgat
aaatttgagtgtgtgtggaatgggtcagacagcgtcatcatgaccggctcctacaacaac
ttcttcaggatgttcgaccgcaacaccaagcgcgatgtgacccttgaggcctcgagggaa
aacagcaaaccccgggctatcctaaaaccccgaaaagtgtgcgtggggggcaagcggaga
aaagacgagatcagtgttgacagtctggactttagcaaaaagatcttgcatacagcttgg
cacccttcagaaaatattatagcagtggcggctacaaataacttatatatattccaggac
aaggttaactag

KEGG   Loxodonta africana (African savanna elephant): 100666680
Entry
100666680         CDS       T04351                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X2
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100666680 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100666680 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    100666680 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    100666680 (PPP2R2D)
   04152 AMPK signaling pathway
    100666680 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100666680 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100666680 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    100666680 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100666680 (PPP2R2D)
   05165 Human papillomavirus infection
    100666680 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100666680 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100666680 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100666680 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:lav03036]
    100666680 (PPP2R2D)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100666680 (PPP2R2D)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100666680 (PPP2R2D)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100666680 (PPP2R2D)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 100666680
NCBI-ProteinID: XP_003419737
LinkDB
Position
Unknown
AA seq 435 aa
MCWRALGATAKKWLLADIISTVEFNYSGDLLATGDKGGRVVIFQREQESKSRPHSRGEYN
VYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAE
GYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVNSDHETY
LSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAGFHPHQCNVFVYSSSKGTIR
LCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDVNFSHSGRYMMTRDYLSVKVWD
LNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGSYNNFFRMFDRN
TRRDITLEASRENSKPRAVLKPRKVCTGGKRKKDEISVDSLDFNKKILHTAWHPVENVIA
VAATNNLYIFQDKIN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtgctggcgggctctgggcgccacagccaagaagtggctgcttgctgacatcatttcg
actgtcgaatttaactactctggagatcttcttgcaacaggagacaagggcggccgagtt
gttatttttcagcgagaacaagagagtaagagccgccctcactctaggggcgagtacaat
gtttacagcacctttcagagtcatgaaccagagtttgactatttgaaaagtctagaaatt
gaggaaaaaattaacaaaattaggtggttgccacaacagaatgctgctcattttctactc
tctacgaatgataaaactattaaattatggaaaataagtgaacgggataaaagagcagaa
ggttataacttgaaagacgaagatggacgactccgagacccatttagaattacagcacta
cgggtccccatattgaagcccatggaccttatggtagaagcaagtcctcgacgaattttt
gcaaatgctcacacatatcatataaattccatttcagtaaatagtgatcatgaaacgtat
ctttctgcagatgacctgagaattaatctgtggcatttagaaatcactgatagaagtttt
aacatcgtggacatcaagcctgctaacatggaggagctgacggaggtgatcacggcagcc
gggttccacccgcaccagtgcaacgtctttgtttacagcagcagcaaaggcaccatccgc
ttgtgtgacatgcgctcctcagccctgtgtgacagacactccaagttttttgaagagccc
gaagaccccagcagtcggtccttcttctcagaaatcatctcctccatctcggacgtgaac
ttcagtcacagcggccgctacatgatgaccagagactacttgtccgtgaaggtatgggac
ctcaacatggagaacaggcctgtggagacgtaccaggttcacgaatatctccgaagcaag
ctttgttctctgtatgagaatgactgcatctttgacaagtttgagtgctgctggaacggc
tctgacagtgctattatgactggatcctacaacaacttctttaggatgtttgataggaac
acacggagggatattacactggaagcgtcacgagagaacagcaaacctcgagctgtccta
aagcctcggaaggtgtgtacaggtggcaagagaaagaaagatgagattagtgttgacagt
ctggacttcaacaagaagattcttcacaccgcctggcaccccgtggagaacgttattgct
gtagccgccaccaataacttgtacatattccaggacaaaatcaactag

KEGG   Loxodonta africana (African savanna elephant): 100668487
Entry
100668487         CDS       T04351                                 

Gene name
PPP2R3A
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100668487 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100668487 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    100668487 (PPP2R3A)
   04152 AMPK signaling pathway
    100668487 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100668487 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100668487 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100668487 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100668487 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100668487 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668487 (PPP2R3A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100668487 (PPP2R3A)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100668487 (PPP2R3A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100668487 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 NPIP DUF4187 DUF4116
Other DBs
NCBI-GeneID: 100668487
NCBI-ProteinID: XP_003420032
LinkDB
Position
Unknown
AA seq 1149 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGVDCIVVHHSVCADLLHIPV
SQFRDADLDCMFLSGENGLSSAESDYSHHALAGVPKIKKGSAIQNTCNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYKKGRKVKSDSFNRRSVDFDLLCGHYNNDRNSPSFGLHRSS
SMEEKSFSDRNSLDLNMTSILLQNFSEEDLVTQILEKHKIDKFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSESSINEGSGHDAISSSETVYMNVMTRLASYLKKLPFEFMQSG
HNEAVDLTELLSNMPSLQLTPFSPVFGTEQPPTYEDVVQLSAPDSGQFQTIELQNEKHNS
RKMNNVKSIPENSTNSLYNLEVNVPRTLKAVQHPSELLTMNPLENVSSRDLMETLYIEEE
SDGKKALNKRQKTENGPNQEFVNQARAEFSDHGTHLKKCPASVQNEIGTIFEKPVVNLLE
EDPKSKAPKVEEGDHRDFLNPNSQEEIDKLLMDLESFSQKMETSLREPIAKGKNSNSLNS
HSQLTGQIPVDLEPKSKVSSPPEKVSPSCLTRIIETNGHKIEEEDRALLLRILESIEDFA
QELVECKSGRGSLSQEKEMMQILQETLTTSSQASLSVCRTPVGDKAKDTTSVVLIQQTPE
VIKIQNKPEKKPGTALPPPATFPSSPQPLSSVTRVNNVVSAPLSVNIPQFYFPEGLPDTC
SNHEQTLNRIETAFLDIEDQKTDIHEMGKIAKVCGCPLYWKAPMFRAAGGERTGFVSAQS
FLEMWRKLLNNHHDDASKFIYLLAKPNCSTLEQEDFIPLLQDVVDTHPGLTFLKDAPEFH
SRYITTVIQRIFYTVNRSWSGKITTTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYV
IYCKFWELDSDHDLYISQTDLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADFV
WFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLL
CQMLDLVKPASDGKITLHDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPE
PSDWDRFAAEEYETLVAEESAQAQFQEGSFEDYETDEPVPPSEFGNKGNKIVTSNLSEKC
GKLQSVDEE
NT seq 3450 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagtactgtgaaccactacagcagcgtggtgatt
gaccggcgttttgagcaagctatacattattgcactggaacctgccacactttcacacat
ggagttgactgcattgtggtacatcatagtgtttgtgcagacctcttgcatatccctgtt
tctcagttcagagatgcggatctggactgtatgtttctatccggtgagaatgggctttcc
tcggctgaaagtgactattctcatcatgccctcgcaggtgtacccaagatcaagaaagga
tctgcaattcagaacacctgcaacttaaaggacattgcaggagaagcaatcagttttgcc
agtgggaaaataaaagaattttcccttgaaaaactcaaaaattctaaccatgcagcttat
aaaaagggaagaaaagttaagtctgactcatttaataggaggtcggttgattttgacttg
ctctgtggccattataacaatgatagaaactccccatcctttggtttacaccggagttcc
tcaatggaagaaaaatctttttctgatcgaaactcacttgatctgaatatgacttccatt
cttctccaaaacttctctgaagaagacctggttactcagattttagaaaaacataaaata
gataaattttcttctgggacagacataaagatgtgcttagacattttgctgaaatgttct
gaggatttgaaaaaatgcacagacatcataaaacaatgcataaagaaaaaatcagagagt
agcatcaatgaaggaagtggtcatgatgcaatttctagctctgaaactgtctatatgaat
gtaatgacgagattagcatcctatctgaaaaaattaccatttgaattcatgcaatctggg
cataacgaggctgtagatttaacagaactgctcagtaatatgcctagtttacaactgact
cccttctccccagtatttggcactgagcaaccccctacatacgaagatgttgtccagctc
tccgcccctgactctggacagtttcaaactattgaattacaaaatgagaagcacaattct
aggaagatgaacaatgtaaaatccattccagagaactccacaaattccttatataactta
gaagtaaatgttcccagaactctaaaagctgtccagcatccatcagagttgttaaccatg
aaccctttagaaaatgtttcttctcgtgacttaatggagactctttatattgaagaagaa
tcagatggaaagaaagcgctcaacaaaagacaaaagacagagaatggacccaatcaggaa
tttgtaaatcaagcaagagcagaattttcggaccatggtactcaccttaagaaatgtcct
gcctcagtgcaaaatgaaattggtactatatttgagaaaccagttgttaatctactggag
gaagaccctaaatcaaaagcccctaaagttgaagagggagaccacagagattttctgaat
cctaacagtcaagaagagatagataaattgttaatggatttggaatctttttcacaaaaa
atggagacctctctaagagagccaattgccaagggtaaaaactctaactctctaaatagt
catagtcagttgactggtcagatccctgtagatcttgagcctaaatctaaagtctcttca
cctccggaaaaagtctcaccttcctgtctaacaaggatcattgaaaccaatggacacaaa
atagaggaagaagatcgagccctcttactgcgaatcctagaaagcattgaagactttgct
caagaactagttgaatgcaaatcaggcagagggagcctatcacaggaaaaggaaatgatg
cagattttacaggagaccttaacaacttcctcccaagccagtttatcagtctgtagaact
cctgttggtgataaagccaaagatactacttccgtggttttgattcagcagactccagag
gtaatcaagattcaaaataaaccagaaaagaaacccggaacagcacttccacctccagcc
acctttccaagcagcccccagcctctgtcctctgttactcgtgtgaataatgttgtgagt
gccccgctgtccgtaaacattccccagttctactttcctgaaggactcccagacacctgc
agtaatcatgaacaaactctgaacagaattgaaacagctttcctggatattgaagatcag
aaaacagacatacatgaaatggggaagattgcaaaggtctgtggctgtcctctctattgg
aaagcccccatgtttagggctgcagggggagagaggacaggatttgtgtcagcacagtca
ttccttgaaatgtggagaaagttgctgaataaccatcatgatgatgcctctaagttcatc
tatcttctagcaaagcccaactgcagtaccctagaacaggaggatttcatcccgttactt
caggatgtggtggatacacaccctggccttacgttcttgaaagatgctccagaattccac
tcccgttacatcaccacggtaattcagagaatattctacacagtcaacagatcatggagt
ggaaaaatcactacgacagagataagaaaaagcaactttttgcaaactctagcccttttg
gaagaagaggaagacataaaccaaatcacagattacttctcctatgaacatttctatgtt
atttattgtaaattctgggaactagatagtgatcatgacctctacatcagccagactgat
ctatctcgatataatgatcaggcttcatcaaacaggattattgaaaggatattctctgga
gcagtaacaaggggaaaaacagtacagaaggagggaagaatgagctatgcagattttgtt
tggtttttgatctctgaggaagacaaaagaaaccccaccagcattgagtattggttccgg
tgcatggacgtggacggggatggtgtactctccatgtacgagctagagtacttctacgag
gagcagtgcgagcggatggaagccatgggcatcgaacccctgccgttccatgatttgctt
tgccagatgcttgacctggtgaagccagccagtgatggcaaaataactctccatgatctg
aagagatgcagaatggctcacatcttttatgacactttctttaatctggagaaatactta
gaccacgaacagagagatccctttgcagttcagaaggatgttgagaatgatgggcctgag
ccctccgactgggacaggtttgctgctgaggaatacgagactcttgtcgcagaggagtct
gcccaagcacagttccaagaaggctcctttgaagactatgaaacagatgaacctgtccct
ccctctgaatttggaaacaaaggaaataaaatagtaacctcaaacctttcagagaaatgt
ggaaagcttcagtcagtggatgaagagtag

KEGG   Loxodonta africana (African savanna elephant): 100668825
Entry
100668825         CDS       T04351                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X2
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100668825 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100668825 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    100668825 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    100668825 (PPP2R2A)
   04152 AMPK signaling pathway
    100668825 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100668825 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100668825 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    100668825 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100668825 (PPP2R2A)
   05165 Human papillomavirus infection
    100668825 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100668825 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100668825 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100668825 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:lav03036]
    100668825 (PPP2R2A)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100668825 (PPP2R2A)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100668825 (PPP2R2A)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100668825 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 100668825
NCBI-ProteinID: XP_010590661
LinkDB
Position
Unknown
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTILKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagcc
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagtcgtcatctttcagcaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcaccttccagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttgccgcagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagttactacactacgagtaccagtctttaggcccatg
gatctaatggttgaggccagtccacgcagaatatttgccaatgctcatacatatcacatc
aactctatttctattaatagtgattatgaaacatatttatctgcagatgatttgcggatt
aatctttggcatctggaaattacggatagaagttttaatatcgtggacattaagcctgcc
aatatggaagagctaaccgaggtgattacagcagcagaattccatccaaacagctgtaac
acatttgtatacagcagcagtaaaggaactattcggttatgtgacatgagggcatctgcc
ctctgtgatagacattctaaattgtttgaagaacctgaagatcccagtaacaggtcattt
ttttctgaaatcatctcttctatttctgatgtaaaattcagccacagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggtgcatgaatacctcagaagtaaactgtgttcactatatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgactgga
tcttacaataatttcttcagaatgtttgacaggaacacaaagcgagacataaccctagaa
gcatcacgagaaaacaataaacctcgtacgattctgaagccacgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaacaagaaaatactt
catacagcctggcaccccaaggaaaatatcattgctgtagccactacaaacaatctgtat
atatttcaagacaaagtaaattag

KEGG   Loxodonta africana (African savanna elephant): 100670795
Entry
100670795         CDS       T04351                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100670795 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100670795 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    100670795 (PPP2R3C)
   04152 AMPK signaling pathway
    100670795 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670795 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100670795 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100670795 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100670795 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100670795 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:lav03036]
    100670795 (PPP2R3C)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100670795 (PPP2R3C)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100670795 (PPP2R3C)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100670795 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 100670795
NCBI-ProteinID: XP_023401879
LinkDB
Position
Unknown
AA seq 453 aa
MDWKEVLRRRLATPNTGPHKKKTEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENSADLDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagaagttcttcgccggcggttagcgacacctaacaccggtccacacaaa
aaaaaaactgagcaagaattaaaagatgaagaaatggatttatttaccaaatactactca
gaatggaaaggaggtagaaaaaacacaaatgaattctataagacgattccccggttttac
tacaggctgccagctgaagatgaagtcttactacagaaattaagagaggaatccagagct
gtctttctgcaaaggaagagcagagaactgttagataacgaagaattacagaacttatgg
ttcttgctggacaaacaccagacgccacctatgattggagaggaagcaatgatcaattat
gaaaattttttgaaagttggtgaaaaagctggaccaaagtgcaagcagttcttcacagca
aaagtctttgctaaactccttcatacagattcctatggaagaatttctatcatgcagttc
tttaattatgtcatgagaaaagtttggcttcaccaaacaagaataggactcagcttatat
gatgtcgctggacaagggtaccttcgggaatctgatttagaaaattacatattggaactt
atccctactttgccacagttagatgggctggaaaaatccttttactccttttatgtctgt
actgcagttaggaagttcttcttctttttggaccctctaagaacagggaagataaaaatt
caagatattttagcatgcagcttcctagatgatttattggagctaagggatgaggaactg
tccaaggaaagtcaagaaacaaattggttttctgctccctctgccctgagggtttatggc
caatatttgaatctcgataaggatcacaatggcatgctcagtaaagaagaactctcccgc
tatggaacagcaactatgacaaatgtgttcttagaccgtgttttccaggagtgtctcact
tacgatggagaaatggactataagacctacctagacttcgttcttgcattagaaaaccga
aaagaacctgcagctctgcagtatattttcaaactgcttgatattgagaacaaaggatat
ctgaatgtcttttcccttaattatttctttagggccatacaggaactaatgaaaatccac
ggacaagatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggtaaaacca
aaggatcctctgaaaatctctcttcaggatttaatcaacagtaatcagggagacacagtc
accaccattctaatcgatctaaatggcttctggacatatgagaacagagaagcccttgtc
gcaaatgacagtgaaaactctgcagaccttgatgatacctga

KEGG   Loxodonta africana (African savanna elephant): 100675562
Entry
100675562         CDS       T04351                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100675562 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100675562 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    100675562 (PPP2R5E)
   04152 AMPK signaling pathway
    100675562 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100675562 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100675562 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    100675562 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100675562 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100675562 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100675562 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:lav03036]
    100675562 (PPP2R5E)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100675562 (PPP2R5E)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100675562 (PPP2R5E)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100675562 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 100675562
NCBI-ProteinID: XP_003408746
UniProt: G3T8X8
LinkDB
Position
Unknown
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagctcctcacagtttaggtctcaaggc
aaacctattgagttaacacctctgcctctgctaaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctacccttgaggcatcgtggccacacttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccagcccagcattgccaaaaaatacatagatcagaaattt
gtattacagcttttggagctatttgacagcgaagacccccgggaacgggactatttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacggaacatttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggctttgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtgttgatccctttacacactgtcaggagcttatcactcttc
catgctcagctggcatattgcatagtacagtttctggagaaagatccttcactcacagaa
ccagttattaggggattaatgaaattttggcccaaaacatgtagtcaaaaagaggtaatg
ttccttggggagctggaggaaatattggatgtgattgaaccttcacagtttgttaaaatt
caagagcctttgtttaaacaaattgccaagtgtgtgtctagcccccattttcaggtggca
gaaagagcactctattattggaataatgaatatatcatgagtttgatagaagaaaactct
aatgtcatccttcccatcatgttttccagcctttataggatttcgaaggaacattggaat
ccggctatcgtggcgttagtgtacaatgtgttgaaggcatttatggaaatgaacagcacc
atgtttgatgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattgtggaaaaaattggaggatctggagttaaagagaggtcttaga
cgtgatgggataattccaacttaa

KEGG   Loxodonta africana (African savanna elephant): 100676230
Entry
100676230         CDS       T04351                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04136  Autophagy - other
lav04140  Autophagy - animal
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04350  TGF-beta signaling pathway
lav04390  Hippo signaling pathway
lav04530  Tight junction
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav05142  Chagas disease
lav05160  Hepatitis C
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100676230 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100676230 (PPP2CB)
   04390 Hippo signaling pathway
    100676230 (PPP2CB)
   04071 Sphingolipid signaling pathway
    100676230 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    100676230 (PPP2CB)
   04152 AMPK signaling pathway
    100676230 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100676230 (PPP2CB)
   04136 Autophagy - other
    100676230 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100676230 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100676230 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100676230 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    100676230 (PPP2CB)
   04730 Long-term depression
    100676230 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100676230 (PPP2CB)
   05165 Human papillomavirus infection
    100676230 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100676230 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100676230 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100676230 (PPP2CB)
   04131 Membrane trafficking [BR:lav04131]
    100676230 (PPP2CB)
   03036 Chromosome and associated proteins [BR:lav03036]
    100676230 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100676230 (PPP2CB)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100676230 (PPP2CB)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     100676230 (PPP2CB)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100676230 (PPP2CB)
Membrane trafficking [BR:lav04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100676230 (PPP2CB)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100676230 (PPP2CB)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100676230 (PPP2CB)
SSDB
Motif
Pfam: Metallophos Glyco_hydro_65N
Other DBs
NCBI-GeneID: 100676230
NCBI-ProteinID: XP_010590772
LinkDB
Position
Unknown
AA seq 244 aa
MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQ
VYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDR
LQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHASGLTMVSRAHQLVM
EGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTP
DYFL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaactcttcagaattggtggaaaatcgccagatacaaactatctattcatgggtgac
tatgtagacagaggttactactcagtggagactgtgactcttcttgtggcgttaaaggtt
cgttatccagaacgcattacaatattgagaggaaaccacgaaagccgacagattacccaa
gtatatggcttttatgatgaatgtctacgaaagtatggaaatgccaacgtttggaagtat
tttacagatctctttgattatcttccacttacggcgctggtagatggacagatattctgc
ctccacggtggcctctctccatccatagatacactggatcatataagagccctggatcgt
ttacaagaagttccacatgagggcccaatgtgtgacctgttatggtcagacccagatgat
cgtggcgggtgggggatatctccacgtggcgctggctacacatttggacaagacatttcg
gaaacatttaaccacgccagcggtctcacgatggtttctcgcgctcaccaacttgtaatg
gagggatataattggtgccatgatcggaatgtggttaccattttcagtgcacccaattac
tgttaccgctgtgggaaccaggctgctatcatggaactagatgacactttaaaatattcc
ttccttcagtttgacccagcgcctcgccgtggagagcctcatgttacccggcgtacccct
gactacttcctgtga

KEGG   Loxodonta africana (African savanna elephant): 100676500
Entry
100676500         CDS       T04351                                 

Gene name
PPP2R5C
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03015  mRNA surveillance pathway
lav04071  Sphingolipid signaling pathway
lav04114  Oocyte meiosis
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04261  Adrenergic signaling in cardiomyocytes
lav04728  Dopaminergic synapse
lav05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100676500 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100676500 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    100676500 (PPP2R5C)
   04152 AMPK signaling pathway
    100676500 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100676500 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100676500 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    100676500 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100676500 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lav01009]
    100676500 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lav03019]
    100676500 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:lav03036]
    100676500 (PPP2R5C)
Protein phosphatases and associated proteins [BR:lav01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     100676500 (PPP2R5C)
Messenger RNA biogenesis [BR:lav03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     100676500 (PPP2R5C)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     100676500 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 100676500
NCBI-ProteinID: XP_010587138
LinkDB
Position
Unknown
AA seq 524 aa
MLTCNKAGSRMVVDAANSNXPFQPVALLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYAVHRQASALNIPVAMETDGPLFEDVQMLRKTGSEDAH
QAQKDPKKDRALVRRKSELPHDPYTKRALDAHCRADELLSQGGH
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaacaaggctggcagcaggatggtggtggacgcggccaactccaacngg
cccttccagcccgtggccctgctacacatccgagatgttcctcctgctgaccaagagaag
ctttttatccagaagttacgtcagtgttgtgtcctctttgactttgtttccgatccactc
agtgacctaaagtggaaggaagtaaagcgagctgctctcagtgaaatggtggaatatatc
acgcacaatcggaatgtgatcacagagccgatttacccggaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctctaatcctacgggagcagaatttgaccca
gaggaagatgagccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatatcgac
cagaagtttgtattgcagcttttagaactctttgacagtgaagatcctcgggagagggat
tttctcaaaactaccctccacagaatctatggaaaattcttaggcttaagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcacaatggc
atagcagaattactggaaatattgggaagtataattaatggatttgccttaccactgaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaagtctctg
agtgtctaccacccacagctggcatactgtgtcgtgcagtttctggaaaaggacagcacc
ctcactgaaccagtggtaatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtcatgtttctcaatgagttggaagaaatcttagacgtgatcgagccctcggagttc
gtgaagatcatggagcctctcttccggcagttagccaagtgtgtgtccagcccacacttc
caggtggcggagcgggcgctgtattactggaataacgagtatatcatgagcttaatcagt
gacaacgcggcaaagatcctgcccatcatgtttccgtccttgtaccgcaactcaaagacc
cactggaacaagacaatacacggcctgatctacaacgcgctgaagctattcatggagatg
aaccaaaaactatttgacgactgcacgcagcagttcaaagccgagaagctgaaagagaag
ctaaaaatgaaagaacgagaagaagcatgggttaaaatagaaaatctagccaaagcgaac
ccccagtacgcagtgcatagacaagccagcgccctgaacatcccggtcgcaatggagaca
gacgggcctttatttgaagatgtacagatgctgagaaagacagggagcgaagatgctcac
caggcacagaaagacccgaagaaggaccgtgctctggtgcgccgcaagtcggagctgcct
cacgacccctacaccaagagagccttggatgcccactgcagagccgacgagctgctgtcc
cagggcgggcactag

DBGET integrated database retrieval system