KEGG   Loxodonta africana (African savanna elephant): 100654493
Entry
100654493         CDS       T04351                                 

Gene name
TLR4
Definition
(RefSeq) toll-like receptor 4
  KO
K10160  toll-like receptor 4
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04064  NF-kappa B signaling pathway
lav04066  HIF-1 signaling pathway
lav04145  Phagosome
lav04151  PI3K-Akt signaling pathway
lav04217  Necroptosis
lav04613  Neutrophil extracellular trap formation
lav04620  Toll-like receptor signaling pathway
lav04621  NOD-like receptor signaling pathway
lav05132  Salmonella infection
lav05133  Pertussis
lav05134  Legionellosis
lav05135  Yersinia infection
lav05140  Leishmaniasis
lav05142  Chagas disease
lav05144  Malaria
lav05145  Toxoplasmosis
lav05146  Amoebiasis
lav05152  Tuberculosis
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05170  Human immunodeficiency virus 1 infection
lav05171  Coronavirus disease - COVID-19
lav05205  Proteoglycans in cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
lav05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100654493 (TLR4)
   04066 HIF-1 signaling pathway
    100654493 (TLR4)
   04151 PI3K-Akt signaling pathway
    100654493 (TLR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100654493 (TLR4)
  09143 Cell growth and death
   04217 Necroptosis
    100654493 (TLR4)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    100654493 (TLR4)
   04620 Toll-like receptor signaling pathway
    100654493 (TLR4)
   04621 NOD-like receptor signaling pathway
    100654493 (TLR4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100654493 (TLR4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100654493 (TLR4)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100654493 (TLR4)
   05321 Inflammatory bowel disease
    100654493 (TLR4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100654493 (TLR4)
   05135 Yersinia infection
    100654493 (TLR4)
   05133 Pertussis
    100654493 (TLR4)
   05134 Legionellosis
    100654493 (TLR4)
   05152 Tuberculosis
    100654493 (TLR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100654493 (TLR4)
   05161 Hepatitis B
    100654493 (TLR4)
   05171 Coronavirus disease - COVID-19
    100654493 (TLR4)
   05164 Influenza A
    100654493 (TLR4)
   05162 Measles
    100654493 (TLR4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100654493 (TLR4)
   05144 Malaria
    100654493 (TLR4)
   05145 Toxoplasmosis
    100654493 (TLR4)
   05140 Leishmaniasis
    100654493 (TLR4)
   05142 Chagas disease
    100654493 (TLR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100654493 (TLR4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:lav04054]
    100654493 (TLR4)
   04090 CD molecules [BR:lav04090]
    100654493 (TLR4)
   00536 Glycosaminoglycan binding proteins [BR:lav00536]
    100654493 (TLR4)
Membrane trafficking [BR:lav04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    100654493 (TLR4)
Pattern recognition receptors [BR:lav04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   100654493 (TLR4)
CD molecules [BR:lav04090]
 Proteins
  100654493 (TLR4)
Glycosaminoglycan binding proteins [BR:lav00536]
 Hyaluronan
  Cell surface receptors
   100654493 (TLR4)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_5 LRR_1 LRR_9 DUF1863 LRRCT
Other DBs
NCBI-GeneID: 100654493
NCBI-ProteinID: XP_003407827
UniProt: G3SYU3
LinkDB
Position
Unknown
AA seq 841 aa
MMPVSRLAGALIPAMTFLSYLRVESWEPCVEVIPNISYRCMEVNLYKIPDNIPSSAKNLD
LSFNPLRHLGSHSFSNFSELQVLDLSRCEIQIIEDGAYWGLNHLFTLILTGNPIQHLALG
TFFGLSGLQKLVAVEINLTSLEDFPIGHLKTLKELNVAHNSIHSFKLPEYFSNLSNLEHL
DLSNNQIRNIFRKDLQILHQIPLLNLSLDLSLNMIDFIQPGAFKEIRLHKLTLRSNFDNM
TVMKMCIQGLAGLEVHQLVMGEFKNERNLDRFDKSALEGLCNLTIEEFRMAYVSDFSSHD
IDVFNCLANVSAVSLVSLNLNELERFPEDYRWQSLELVNCKLQPFPALALSSLKRFVLTA
NKNSNTIVEFKLPSLEFLDLSGNVLSLRGCCSQSDFGTTKLKYLDLSFNNVIVMNSNFLG
LEQLKHLDFRYSTLKHVNDFPPFLSLTKLLYLDISHTHIHVVFHGIFLGLYSLKVLKMAG
NSFQDNFLPDIFTDLTDLIFLDLSYCQLEQVSRGAFDSLLRLQVINMSSNNLLSLDTLPF
KYLHSLQVLDCSFNHIVASKVQELQHLPSNLTLLNLTQNDFACICEHQSFLQWVKDQRQL
LVEVEQMVCATPSDMHGRPVLSFRNTTCQMSKTVISASVLSVFIVSLMLVLAYKFYFHLM
LLAGCRRYGGGECTYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
ANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSHAGIIFIILQKVEKSLL
RQQVELYRLLNRNTYLEWEDSVLGKHIFWRRLRKALLAGKPWNPEGTADAENNQLEATTF
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgatgcctgtctcacgcctggctggggctctgataccagccatgaccttcctctcctac
ttgagagtggagagctgggagccctgcgtggaggtaattcctaacatttcttaccgatgc
atggaggtgaatctctacaaaatacctgacaacattccctcatcagccaagaacctggat
ctgagctttaaccccctgaggcacttaggtagccatagcttctccaacttctcagaactg
caggtgctggatttatccaggtgtgaaattcagataattgaagatggtgcatattgggga
ctaaatcatctcttcaccttgatattaacgggaaaccctatccagcatttagccctggga
accttttttggactatcaggtttgcaaaagctggtggctgtggagataaacctaacctct
ctagaggacttccccattgggcatcttaaaactttgaaggagcttaatgtagctcacaat
tctatccattccttcaaattacctgaatatttttctaacctgtccaacctggaacacttg
gacctttccaataaccagatccgaaatatttttcgtaaagacttgcagatcctacatcaa
attcctctactcaatctctctctagacctgtccctgaacatgatagactttatccaacca
ggtgccttcaaagaaattaggcttcataaactgactttgagaagcaattttgataatatg
actgtaatgaaaatgtgtattcaaggtctggctggtttagaagtccatcagttggtcatg
ggagaatttaaaaatgaaaggaacttggacaggtttgacaaatctgctctggagggacta
tgcaatttgacaattgaagaattccggatggcatatgtcagcgacttctcatcacatgat
attgatgtatttaattgcttggcaaatgtttctgcagtttctctggtgagtctgaatcta
aatgagttagaaagatttcctgaagattacagatggcaatccttagaactggttaactgt
aaacttcaaccatttcctgcactggcactttcctctctgaaaagatttgttttaactgcc
aataaaaatagtaacactattgtcgagtttaaactaccaagccttgagtttctagatctc
agtggaaatgtattgagtctcagaggttgttgttctcagtctgattttgggacaaccaag
ctgaagtatttagatctgagcttcaataatgttattgtcatgaattcaaacttcctgggc
ttggaacaactaaaacatctagatttccgatattccaccttgaaacatgtcaatgatttt
ccaccatttctatcactcacaaaactactttaccttgacatttctcacacccatattcac
gttgtcttccacggcatctttcttggcttgtatagcctcaaagtcttaaaaatggctggc
aattcttttcaggacaacttccttccagatatcttcacagatctgactgacttgattttc
ttggacctctcttactgccaactggaacaggtgtcccgaggagcttttgactcacttctc
agactacaggtgataaatatgagttccaacaacctcctgtccttggatacacttcccttt
aaatatctccactcgcttcaagttctagactgtagtttcaatcatatagtggcctccaag
gtacaagaactacaacatcttccaagtaacctaactctcttaaatcttacccagaatgac
tttgcttgtatttgtgagcaccagagtttcctgcagtgggtcaaggaccagaggcagctc
ttggtggaagttgaacaaatggtgtgtgcgacaccttcagacatgcacggcaggcctgtg
ctgagttttaggaacaccacctgtcagatgagtaagactgttatcagtgcgtcagttctc
agtgtgttcatagtatctctgatgctagttttggcctataagttctatttccacctgatg
cttcttgcaggctgcagaagatatggtggcggcgaatgcacctatgatgcctttgttatc
tactctagccaggatgaggactgggtgaggaatgagctggtaaagaacctggaagaggga
gtgcccccctttcagctctgccttcactatagagactttatcccaggtgtggccatcgcc
gccaacatcatccaggaaggtttccacaaaagccggaaagttattgtcgtggtgtctcag
cacttcatccagagccgctggtgtatcttcgagtatgagattgcccagacctggcagttt
ttgagcagtcatgctggcattatcttcatcatcctgcagaaggtggagaagtccctgctc
cggcagcaggtggagctgtaccgccttctcaacaggaacacctacctggagtgggaggac
agtgtcctgggaaaacacatcttctggagacgtctcagaaaagccctgttagctgggaaa
ccatggaatccagaaggaacagcagatgcagagaacaaccagcttgaagcaacaactttt
acctga

DBGET integrated database retrieval system