KEGG   Loxodonta africana (African savanna elephant): 100654542
Entry
100654542         CDS       T04351                                 

Gene name
KCNK2
Definition
(RefSeq) potassium channel subfamily K member 2 isoform X1
  KO
K04913  potassium channel subfamily K member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
lav04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100654542 (KCNK2)
  09154 Digestive system
   04971 Gastric acid secretion
    100654542 (KCNK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100654542 (KCNK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100654542 (KCNK2)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   100654542 (KCNK2)
SSDB
Motif
Pfam: Ion_trans_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100654542
NCBI-ProteinID: XP_003419919
UniProt: G3T8X2
LinkDB
Position
Unknown
AA seq 426 aa
MLPSASRERPGCRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISEHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNNNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgcttcccagcgcctcgcgggagagacctggctgtagagcaggagtggcggcacccgac
ttgttggatcctaaatctgctgctcagaactccaaaccaaggctctcgttttccacgaaa
cccacagtgcttgcttcccgggtggagagtgacacgaccattaatgttatgaaatggaag
acggtctccacgattttcctggtggttgttctctatctaatcattggagccaccgtgttc
aaagcattggagcaacctcatgagatttcgcagagaaccaccatcgtgatccagaaacaa
acgttcatatccgaacactcctgtgtcaactccaccgagctggacgagctcatccagcaa
atagtggcagcaataaatgcagggattatacctttaggaaacacctccaatcaaatcagt
cactgggatttgggaagttccttcttctttgctggcactgttattacaaccatcgggttt
ggaaacatctcaccacgtacagaaggaggaaaaatattctgtatcatctatgccttactg
ggaattcccctctttggctttttgttggccggagttggagaccaactagggaccatattt
ggaaaaggaattgcaaaagtagaagatacatttattaagtggaacgttagtcagaccaag
attcgtatcatctcaaccatcatatttatactgttcggctgcgtgctctttgttgctctg
cccgcgatcatattcaagcatatagaaggctggagtgccctggacgccatttactttgtg
gttattactttaacaaccatcggatttggtgactacgttgcaggtggatcagatattgaa
tatctagacttctacaagccggtggtgtggttttggatccttgtcgggcttgcctacttt
gctgctgttctgagcatgattggtgactggctccgagtgatatccaaaaagacgaaggaa
gaggtgggagaattcagggctcatgccgctgagtggacagccaatgtcacagctgaattc
aaagagaccaggaggcggctaagcgtggagatttatgacaaattccagcgtgccacctcc
attaaacggaaactctcagcagaactagccggaaacaacaatcaagagctgactccttgt
aggaggaccctgtccgtgaaccacctgaccagcgagagggatgtcttgcctcccttactg
aagactgaaagtatttatctgaatggtttgacaccacattgtgctggtgaagagattgct
gttattgagaacattaaatag

DBGET integrated database retrieval system