KEGG   Loxodonta africana (African savanna elephant): 100654684
Entry
100654684         CDS       T04351                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04068  FoxO signaling pathway
lav04110  Cell cycle
lav04114  Oocyte meiosis
lav04115  p53 signaling pathway
lav04218  Cellular senescence
lav04914  Progesterone-mediated oocyte maturation
lav05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100654684 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100654684 (CCNB1)
   04114 Oocyte meiosis
    100654684 (CCNB1)
   04115 p53 signaling pathway
    100654684 (CCNB1)
   04218 Cellular senescence
    100654684 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100654684 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100654684 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100654684 (CCNB1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100654684 (CCNB1)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100654684 (CCNB1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100654684 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100654684
NCBI-ProteinID: XP_003408123
UniProt: G3UMQ4
LinkDB
Position
Unknown
AA seq 425 aa
MALRVTRNTKINAELKPKTSMAGAKRVPMATAAAPKPGLRPRIALGDIGNKVSEQPQAKM
PLKKEAKTSAAGKVIAKKLPKPLDKAPLHEPEPEPELEREPVKEEKLSPEPILVDTPSAS
PMETSGCAPAEEYLCQAFSDVILAVSDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVR
PKYLVGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVG
VTAMFIASKYEEMYPPEIGDFAFVTDHTYTKHQIRQMEMKILKALNFGLGRPLPLHFLRR
ASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHY
LSYTEECLFPVMQHLAKNIVMVNQGLTKHMTIKNKYATSKHAKISTLAQLNSAVVQDLAK
AVAKV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcacttcgagtcaccaggaacacgaaaattaatgctgaacttaagccgaaaaccagt
atggcaggcgccaagcgagtgcctatggccactgctgcagcccccaagcccgggctgagg
ccaagaatagctcttggagacattggtaacaaagtcagtgaacagccacaagccaaaatg
cccctgaaaaaggaagcaaaaacttcagctgctggaaaagttattgccaaaaaactgccc
aaaccactggacaaggcacctttgcatgagcctgagccagagcctgagctagaacgtgag
cctgttaaggaagaaaagctttcgcctgagcctattttggtggatactccctctgcaagc
ccgatggaaacatctggatgtgcccctgcagaagaatatctgtgtcaggctttctctgat
gtaatccttgcagtgagtgatgtggatgcagaagatggagctgatccaaacctttgtagt
gaatatgtgaaagatatctatgcttatctgagacaacttgaggaagagcaagccgtcaga
ccaaaatatctagtgggtcgggaagtcactggaaacatgagagccatcctaattgactgg
ctagtgcaggttcaaatgaaattcaggttgctgcaggaaacgatgtatatgactgtttcc
atcattgaccggttcatgcagaataattgtgtgcctaagaagatgttgcagctggttggt
gtcactgccatgtttattgcaagcaaatacgaagaaatgtaccctccagaaattggtgac
tttgcctttgtgactgaccatacttacactaagcaccagatcagacagatggaaatgaag
attctaaaagctttaaactttggtctgggtcgccctctgcccctgcacttccttcggaga
gcatccaagattggagaggttgatgttgagcaacatactttggccaaatacttgatggaa
ctaactatgttggactatgatatggtgcactttcctccttctcagatagcagcaggagct
ttttgcttagcactgaaaattctcgataatggtgaatggacaccaactctacagcattac
ctgtcatacactgaagaatgcctttttcctgttatgcagcacctggctaagaatatagtc
atggtgaatcaagggcttacaaaacacatgactatcaagaacaagtatgccacgtctaaa
catgccaagatcagcacactagcacagctgaattctgcagtagttcaagatctagccaag
gctgtggcaaaggtgtaa

DBGET integrated database retrieval system