KEGG   Loxodonta africana (African savanna elephant): 100654848
Entry
100654848         CDS       T04351                                 

Gene name
NR4A1
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100654848 (NR4A1)
   04151 PI3K-Akt signaling pathway
    100654848 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100654848 (NR4A1)
   04927 Cortisol synthesis and secretion
    100654848 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100654848 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100654848 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lav03310]
    100654848 (NR4A1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    100654848 (NR4A1)
Nuclear receptors [BR:lav03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   100654848 (NR4A1)
SSDB
Motif
Pfam: Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100654848
NCBI-ProteinID: XP_003405502
LinkDB
Position
Unknown
AA seq 600 aa
MPCIQAQYGTTAPSAGAHDHLASDPLTPELSKSTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASTAFKFEDFQVYGCYPGTLSGPL
DETLSSSGSDYYGSPCSVPSPSTPSFQPPQLSPWDGSFGHFSTSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSTHTGPSPSLAQSPLKLFPSQATHQLREGESYSMPAAFPGLAPTSPHL
DGSGILDVPVTSAKARSGAPSGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTTKLDYSKFQELMLPRFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFTELSPGDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVS
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKILWTRFLSDL
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgccctgtatccaagcccagtatgggacaacagcaccgagcgcaggagcccatgaccac
ctggcaagcgaccccctgacccctgagctcagcaagtccaccatggacctggccagccct
gaggcggcccccgctgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggagagttcgacaccttcctctaccagctgccaggaacagtgcagccgtgctcctcc
gcctcctcctcagcctcctccacgtcctcttcctcagccacttcccccgcctctactgcc
ttcaagtttgaggacttccaggtgtatggctgctacccaggcaccctgagcggcccacta
gatgagaccctgtcctccagcggctctgactattacggcagcccctgctcagtcccatca
ccatccacgcccagcttccagccaccccagctctctccttgggatggctcatttggtcac
ttctcaaccagccagacttacgaaggcctgcgggcatggacagagcagctgcccaaggcc
tctgggccccctcagcccccagccttcttctccttcagcacccacactggccccagcccc
agccttgcccaaagccccctgaagctcttcccctcacaggccacccaccagctgagggag
ggtgagagctattccatgccagcagctttcccaggcttggcacccacctccccacacctt
gatggctcgggaatactggatgtgcctgtaacttcggccaaggcccggagtggggctccc
agtggaagcgagggccgctgtgccgtgtgtggggacaacgcttcatgtcagcattacggc
gtccgcacctgtgagggctgcaagggcttcttcaagcgcacagtacagaaaaacgccaag
tacatctgcctggccaacaaggactgccctgtggacaagagacggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggctgtgggcatggtgaaggaagttgtccggacagac
agtctgaagggacggcggggccggctcccctcaaaacccaagcagcccccagatgcctcc
cctgccaacctcctcacttccctggtccgggcacacctggactcggggcccagcactacc
aaactagactactccaagttccaggagctgatgctgccccgctttgggaaggaagatgcc
ggggatgtgcagcagttctacgacctgctctcgggttccctggaggttatccgcaagtgg
gccgagaagatccccggctttactgagctgtcaccaggcgaccaggacctgctgctggag
tcggcctttctggagctcttcatcctccgcctggcctaccggtccaagcctgccgagggg
aagctcatcttctgctcaggcctggtgctgcatcggctgcagtgtgcccgcggtttcggc
gactggattgacagcatcctggccttctcacggtccctgcacagcttggttgtcgacgtc
cctgcctttgcctgcctgtctgctcttgtccttatcaccgaccggcacgggctgcaggag
ccgcggcgggtggaggaactgcagaaccgcatcgccagctgcctgaaggaacatgtctca
gctgtggcgggtgagccccagccggccagctgcctgtcccgcctgctgggcaagctacct
gagctgcgaaccctgtgcacccagggcctgcagcgcatcttctacctcaagctggaggac
ttggtgccccctccgcccatcgttgacaagatcttgtggacacgctttctttctgacctc
tag

DBGET integrated database retrieval system