KEGG   Loxodonta africana (African savanna elephant): 100654979
Entry
100654979         CDS       T04351                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04152  AMPK signaling pathway
lav04218  Cellular senescence
lav04914  Progesterone-mediated oocyte maturation
lav05161  Hepatitis B
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100654979 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100654979 (CCNA2)
   04218 Cellular senescence
    100654979 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100654979 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100654979 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100654979 (CCNA2)
   05203 Viral carcinogenesis
    100654979 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100654979 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100654979 (CCNA2)
   05161 Hepatitis B
    100654979 (CCNA2)
   05169 Epstein-Barr virus infection
    100654979 (CCNA2)
   05165 Human papillomavirus infection
    100654979 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100654979 (CCNA2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100654979 (CCNA2)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100654979 (CCNA2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100654979 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 100654979
NCBI-ProteinID: XP_010588901
LinkDB
Position
Unknown
AA seq 439 aa
MNSRRSGGAVRFISGRSRSLGSPRPAVPACSFRSLLRPAQPLPGITLLRGEATRSLLPLP
IWLRECFYFRKGYKKILLVAPLKDIPVNDERVTVAPWKANSKQPAFTIHVDEEEEKTQKR
PAESKKSACEDALAFNSAVTLPGTRKPLGSLDYPMDGSFESPHTMDISVVLEDEKPVNVN
EVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLY
LAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLR
MEHLVLKVLAFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPS
IIAGAAFHIALYTVTGQSWPESLVRKTGYTLESLKPCLMDLHQTYLRAPQHAQQSIREKY
KNSKYHGVSLLNPPETLNV
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaacagccgccgctccggcggggctgttcgctttatctcggggcgttctaggtccctt
ggttctccacggccggcagtgcctgcctgctcctttcgcagcctcctccgccccgcacag
cccctgccaggcattactctgctccggggcgaagcaaccaggtctctccttcccctcccc
atctggttaagagaatgcttctactttagaaaagggtacaagaaaatacttttggttgca
cctcttaaggatattcctgtaaatgatgagcgtgtcactgttgctccatggaaggcaaac
agtaaacagcctgcattcaccattcatgtggatgaagaagaagaaaagactcagaagaga
ccagctgaatctaaaaaatcggcgtgtgaagatgccctggcttttaactcagctgttact
ttacctggaacaagaaaaccgctggggtctctcgattatccgatggatggtagtttcgag
tcaccacatactatggacatatcagttgtattagaagatgaaaaaccagtgaatgttaac
gaagtaccagactatcatgaagacattcacacataccttagggagatggaggttaaatgt
aagcctaaagtgggttatatgaagaaacaaccagacatcactaacagtatgagggctatc
cttgtggactggttagttgaagtaggagaagaatataaactacagaatgagaccctgtat
ttggctgtgaactacattgataggttcctttcatcgatgtccgtattgagaggaaaactt
cagcttgtgggcactgctgctatgctcctagcctcaaagtttgaagaaatatatcctcca
gaagtagcagaatttgtatacattacagatgacacctataccaagaaacaagttctgaga
atggagcatctcgttctgaaagtccttgcttttgacttagcagcaccaacagtaaatcag
tttcttacccaatactttctgcatcagcagcctgcaaactgcaaagttgaaagtttagcg
atgtttttgggagagttaagtttgatagatgccgacccatacctaaagtatttgccatca
attattgctggagcagcctttcatatagcactctacacagtcacaggacaaagctggcct
gagtcattagtacgaaagactggatataccctggaaagtcttaagccttgtctcatggac
cttcaccagacctacctcagagcaccacagcatgcacaacagtcaataagagaaaagtac
aaaaattcaaagtatcatggtgtttctctcctcaacccaccagagacactaaatgtgtaa

KEGG   Loxodonta africana (African savanna elephant): 100667107
Entry
100667107         CDS       T04351                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04152  AMPK signaling pathway
lav04218  Cellular senescence
lav04914  Progesterone-mediated oocyte maturation
lav05161  Hepatitis B
lav05165  Human papillomavirus infection
lav05166  Human T-cell leukemia virus 1 infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05203  Viral carcinogenesis
lav05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100667107 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100667107 (CCNA1)
   04218 Cellular senescence
    100667107 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100667107 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100667107 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100667107 (CCNA1)
   05203 Viral carcinogenesis
    100667107 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100667107 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100667107 (CCNA1)
   05161 Hepatitis B
    100667107 (CCNA1)
   05169 Epstein-Barr virus infection
    100667107 (CCNA1)
   05165 Human papillomavirus infection
    100667107 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lav03032]
    100667107 (CCNA1)
   03036 Chromosome and associated proteins [BR:lav03036]
    100667107 (CCNA1)
DNA replication proteins [BR:lav03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100667107 (CCNA1)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100667107 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 100667107
NCBI-ProteinID: XP_010587656
UniProt: G3SMW8
LinkDB
Position
Unknown
AA seq 421 aa
MRRSSSKSGVVLAPAAGVHDACQMIGRAQLGQDPHQRTVLGVLTENGQYRRACGQGTTTV
RYFSGSENAFPPAGKKALSAFGVRVPPKQGFDIYMDEAEQGDRDSCSGREEMAFEEVCEV
DSSTHKSDLHFLLDFSTVSPMLVDASLHPRSEDASDSGSDVINVTEYAEEIHQYLREAEV
RHRPKAHYLRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQEVCIRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLAAFTGYSLSEIVPCLSELHKACLDMPHRPQQAIREKYKASKYMHVSLMEAPAVLSL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcggcgaagcagctctaagagcggcgttgtcctggcccctgcggctggggtccatgat
gcctgtcagatgatcggcagagcccagctgggccaggacccccaccagaggaccgtgctg
ggggtgcttaccgagaatgggcagtacaggagggcctgcggccaggggaccacaactgtc
aggtatttctcgggatcagaaaatgccttccctccagctgggaaaaaggcgctgtctgcc
ttcggagtccgtgtgccacccaagcaaggatttgacatctacatggatgaggctgagcag
ggggacagagacagctgttcagggagagaggaaatggcgtttgaggaggtgtgcgaggtg
gattccagcactcacaagtcggacctccacttcctgctggatttcagcacagtttccccg
atgctggtcgacgcctctctccacccccggtctgaagatgcctctgactctggttccgat
gtgataaatgtgactgaatatgctgaagaaattcatcagtacctcagagaagctgaagtc
agacacaggcccaaagcacactacctgaggaagcagccggacatcacggagggcatgcgc
gccatcctggtggactggctggtggaggtcggggaggagtacaagctccgcacggagacc
ctgtacctggccgtcaacttcctggacaggttcctctcctgcatgtcagttctgaggggg
aaactgcagcttgtggggacagcagctattcttctggcctcgaaatacgaagagatctat
ccccctgaagtagacgagtttgtctacataactgatgatacgtacaccaagcgacaactg
ctgagaatggaacatctgctcctgaaagtcctggcctttgacctgactgtgccaaccacc
aaccagttcctccttcagtacttaaggaggcaagaagtgtgcatccggacagagaacctg
gccaagtatgtagcagaactgagtctacttgaagctgatccgttcttgaaatatcttcct
tcattgatagccgcagcagcttattgtctggcaaactatactgtaaacaggcacttctgg
ccagaaaccctggctgcctttacaggctactcactgagtgagattgtgccttgcctaagt
gagctacacaaagcctgcctggacatgccccatcggccgcagcaagcaatcagggagaag
tacaaggcttcaaagtacatgcacgtgtctctcatggaagcccctgcagttctttctctg
caatga

DBGET integrated database retrieval system