KEGG   Loxodonta africana (African savanna elephant): 100655007
Entry
100655007         CDS       T04351                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04620  Toll-like receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04912  GnRH signaling pathway
lav04926  Relaxin signaling pathway
lav04935  Growth hormone synthesis, secretion and action
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05142  Chagas disease
lav05161  Hepatitis B
lav05166  Human T-cell leukemia virus 1 infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655007 (MAP2K4)
   04012 ErbB signaling pathway
    100655007 (MAP2K4)
   04668 TNF signaling pathway
    100655007 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100655007 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100655007 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100655007 (MAP2K4)
   04926 Relaxin signaling pathway
    100655007 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100655007 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100655007 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100655007 (MAP2K4)
   05135 Yersinia infection
    100655007 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100655007 (MAP2K4)
   05161 Hepatitis B
    100655007 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100655007 (MAP2K4)
   05169 Epstein-Barr virus infection
    100655007 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100655007 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655007 (MAP2K4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100655007 (MAP2K4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100655007 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 100655007
NCBI-ProteinID: XP_023412247
LinkDB
Position
Unknown
AA seq 338 aa
MDTEEQLQWCAGERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVH
KPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELM
STSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSG
NIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELA
TGRFPYPKWNSVFDQLTQVVKGDPPQLTNSEEREFSPSFINFVNLCLTKDESKRPKYKEL
LKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggacacagaagaacagttgcagtggtgtgcaggagagagactgagaacacacagcatt
gaatcgtcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggac
ttgaaagaccttggagaaattggacgcggagcttatggttctgtcaacaaaatggtccac
aaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaagaa
caaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatatatt
gttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggagctcatg
tctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttattccc
gaagagattttaggaaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaa
aacttgaaaatcattcacagagatatcaaaccttccaatattcttctggacagaagtgga
aatattaaactctgtgacttcggcatcagtggacagcttgtggattccattgccaagaca
agagatgcagggtgtaggccatacatggcgcctgaaagaatagacccaagtgcatcacga
caaggatatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggcc
acaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtcgtg
aaaggagatcctccacagctgactaattctgaggaaagggaattctccccaagtttcatc
aactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagaactt
ctgaaacatccctttatcttgatgtatgaagaacgtaccgtagaggtcgcatgctatgtt
tgtaaaatcctggatcaaatgccggctactcccagctctcccatgtatgtcgattga

KEGG   Loxodonta africana (African savanna elephant): 100673238
Entry
100673238         CDS       T04351                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04012  ErbB signaling pathway
lav04141  Protein processing in endoplasmic reticulum
lav04380  Osteoclast differentiation
lav04530  Tight junction
lav04620  Toll-like receptor signaling pathway
lav04660  T cell receptor signaling pathway
lav04664  Fc epsilon RI signaling pathway
lav04668  TNF signaling pathway
lav04722  Neurotrophin signaling pathway
lav04912  GnRH signaling pathway
lav04926  Relaxin signaling pathway
lav05010  Alzheimer disease
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05132  Salmonella infection
lav05135  Yersinia infection
lav05161  Hepatitis B
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05170  Human immunodeficiency virus 1 infection
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100673238 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100673238 (MAP2K7)
   04012 ErbB signaling pathway
    100673238 (MAP2K7)
   04668 TNF signaling pathway
    100673238 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100673238 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100673238 (MAP2K7)
   04660 T cell receptor signaling pathway
    100673238 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    100673238 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100673238 (MAP2K7)
   04926 Relaxin signaling pathway
    100673238 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100673238 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100673238 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100673238 (MAP2K7)
   05016 Huntington disease
    100673238 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    100673238 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100673238 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100673238 (MAP2K7)
   05135 Yersinia infection
    100673238 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100673238 (MAP2K7)
   05161 Hepatitis B
    100673238 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100673238 (MAP2K7)
   05169 Epstein-Barr virus infection
    100673238 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100673238 (MAP2K7)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100673238 (MAP2K7)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: STE group
  STE7 family
   100673238 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 100673238
NCBI-ProteinID: XP_023396264
LinkDB
Position
Unknown
AA seq 463 aa
MEGGPCWTLQCCLSVPSVDEAGLGRGLGCLKGWLTQQTLPQEQSEAVAGRPQGAPSRRSP
LQVSVSMCAPSHPPISVGFYPSLQFGVSHSPYPHPLLIYDLISFLLDKSVVSVVIYCGVV
FFLPFPHPVIVITLSPAPAPSQRAALQLPLANDGGNRSPSSESSPQHPTPPVRPRHMLGL
PSALYTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKM
CFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAME
LMGTCAEKLKKRMQGPIPERILGKMTVAIVKALFYLKEKHGVIHRDVKPSNILLDERGQI
KLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELAT
GQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDW
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggaggggggtccttgctggactctgcagtgctgcctctctgtccccagcgtggatgag
gcagggctgggtaggggcctggggtgccttaaggggtggctaacccagcagaccctgccc
caggagcagagcgaggctgtggcaggcaggccccaaggagccccctccaggaggagcccc
ctccaggtgtctgtgtctatgtgcgctccatcccaccctcccatctctgtcggtttctac
ccatctctgcagtttggtgtctcacactccccctacccccaccccctgctcatttatgat
ttgatttcttttcttttggacaaatcggttgtttctgttgtgatttattgtggtgttgtt
ttttttcttccttttccccatccagttattgtgatcactctaagccctgctcctgccccg
tcccaacgagcagccctgcagctcccgctggccaacgatgggggcaaccgctcaccatca
tcagagagctccccacagcaccccacgccccccgtccggccccgccacatgctggggctt
ccgtccgccttgtacacaccccgcagcatggagagcattgagattgaccagaagctgcag
gagattatgaagcagactggctacctgaccatcgggggccagcgctaccaggcagaaatc
aacgacctggagaacctgggtgagatgggcagtggcacgtgcggccaggtgtggaagatg
tgtttccgaaagacagggcacatcatcgccgtcaagcaaatgcggcgctcggggaacaag
gaggagaacaaacggatcctcatggacctggacgtggtgctcaagagccatgactgcccc
tacatagtgcagtgcttcgggaccttcatcaccaacaccgatgtctttatcgccatggag
ctcatgggcacgtgcgccgagaagctcaagaagcggatgcagggccccatcccagagcgc
atcctgggcaagatgacggtggcgattgtgaaggcgctcttctatctgaaggagaagcac
ggtgtcatccaccgcgacgtcaagccctccaacatcctgctggatgagcggggccagatc
aagctgtgcgatttcggcatcagtggccgcctcgtcgactccaaggccaagacacgcagc
gctggctgcgccgcctacatggcgcccgaacgcatcgaccccccagaccccaccaagccg
gactatgacatccgggctgacgtgtggagtctcggcatctcgctggtggagctggccaca
ggacagtttccctacaagaactgcaagacagactttgaggtcctcaccaaagtcctccag
gaagagccccctctcctgcctggtcacatgggcttctcaggggactttcagtccttcgtc
aaagactggtga

DBGET integrated database retrieval system