KEGG   Loxodonta africana (African savanna elephant): 100655087
Entry
100655087         CDS       T04351                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav01522  Endocrine resistance
lav04010  MAPK signaling pathway
lav04014  Ras signaling pathway
lav04015  Rap1 signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04114  Oocyte meiosis
lav04140  Autophagy - animal
lav04144  Endocytosis
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04152  AMPK signaling pathway
lav04211  Longevity regulating pathway
lav04213  Longevity regulating pathway - multiple species
lav04510  Focal adhesion
lav04520  Adherens junction
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04730  Long-term depression
lav04913  Ovarian steroidogenesis
lav04914  Progesterone-mediated oocyte maturation
lav05200  Pathways in cancer
lav05202  Transcriptional misregulation in cancer
lav05205  Proteoglycans in cancer
lav05214  Glioma
lav05215  Prostate cancer
lav05218  Melanoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655087 (IGF1R)
   04014 Ras signaling pathway
    100655087 (IGF1R)
   04015 Rap1 signaling pathway
    100655087 (IGF1R)
   04066 HIF-1 signaling pathway
    100655087 (IGF1R)
   04068 FoxO signaling pathway
    100655087 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100655087 (IGF1R)
   04152 AMPK signaling pathway
    100655087 (IGF1R)
   04150 mTOR signaling pathway
    100655087 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100655087 (IGF1R)
   04140 Autophagy - animal
    100655087 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100655087 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100655087 (IGF1R)
   04520 Adherens junction
    100655087 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100655087 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100655087 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100655087 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100655087 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100655087 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100655087 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100655087 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100655087 (IGF1R)
   05205 Proteoglycans in cancer
    100655087 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100655087 (IGF1R)
   05214 Glioma
    100655087 (IGF1R)
   05218 Melanoma
    100655087 (IGF1R)
   05215 Prostate cancer
    100655087 (IGF1R)
   05224 Breast cancer
    100655087 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100655087 (IGF1R)
   01522 Endocrine resistance
    100655087 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100655087 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lav04090]
    100655087 (IGF1R)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100655087 (IGF1R)
Protein kinases [BR:lav01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100655087 (IGF1R)
CD molecules [BR:lav04090]
 Proteins
  100655087 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 100655087
NCBI-ProteinID: XP_010592155
LinkDB
Position
Unknown
AA seq 1368 aa
MKSGSGEGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLRRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHAECLGSCS
APDNATACVACRHYYYAGICVPTCPPNTYKFEGWRCVDRDFCANIPNAESNDAEGFVIHD
GECMQECPSGFIRNGTQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPTNKDIEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANPTMSSRSRNTTMADTYNVTDPEELETEFPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
ESRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTEPVFFYVPTKIRPYENFIHLIISVPVAALLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEMENNPALAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAAR
NCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFG
VVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSF
LEIIGSVKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPLPDR
HSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggagaagggtccccgacctcgctgtgggggctcttgttcctctcc
gcggcgctctcgctctggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aatgactaccagcagctgaggcgcctggagaactgcacggtgatcgagggctacctgcac
atcctgctcatctccaaggcggaggactaccgcagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgcgtggccggcctcgagagtctcggcgacctcttc
ccgaacctcacggtcatccgcggctggaagctcttctacaactatgccctggtcatcttc
gagatgaccaacctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgaaaagaatgctgacctctgctacctctccactgtggactggtccctgatc
ctggatgctgtgtccaataactacatcgtgggcaacaaacccccgaaggagtgtggggac
ctgtgtccgggaacgatggaggagaagccattgtgtgagaagaccaccattaacaatgag
tacaactaccgctgctggaccaccaaccgctgccagaaaatgtgcccgagtgcctgcgga
aagcgagcgtgcaccgagaacaacgagtgctgccatgccgagtgcctgggcagctgcagc
gcacccgacaacgccacggcctgcgtcgcctgccgccactactactacgcaggcatctgc
gtgcccacctgcccacccaacacctacaagtttgagggctggcgctgcgtggaccgggac
ttctgcgccaacatccccaatgctgagagcaacgacgccgagggcttcgtcatccacgat
ggggagtgcatgcaggagtgcccatcggggttcatccggaacgggacccagagcatgtac
tgtatcccttgcgaaggtccttgccccaaagtctgtgaggaagagaagaaaacaaagacc
attgattctgtgacttctgcacaaatgctgcaaggatgcaccatcttcaagggcaacttg
ctcatcaatattcgacgaggcaataacattgcctcggagctggagaacttcatgggtctc
atcgaggttgtgacgggctacgtgaagatccgccattcccacgccttggtctccctgtct
ttcctgaaaaatctccgccagattttaggggaggagcagctagaagggaattactccttc
tacgtcctggacaaccagaacctgcagcagctgtgggactgggaccaccgcaacctgaca
atcaaagcagggaaaatgtactttgcttttaatcccaagttgtgcgtttccgaaatttac
cgcatggaggaagtgacagggactaaagggcgccagagcaaaggggacataaacacaagg
aacaacggagaaagagcctcttgtgaaagcgatgtgctgcatttcacctccaccaccacg
tggaagaatcggattatcatcacctggcaccgctaccggccccctgactacagggatctc
atcagcttcactgtgtactataaggaagccccctttaaaaacgtgacggagtatgacggg
caggacgcctgtggctccaacagctggaacatggtggacgtggacctccccaccaacaag
gacatcgagccaggcattttactgcacggactgaagccctggactcagtacgccgtttac
gtcaaggcagtgactctcaccatggtggagaacgaccacatccgcggggccaagagtgaa
atcttatacattcgcaccaatgcatcagttccttccatccccctggatgttctttcagca
tcaaactcctcttctcaattgattgtgaagtggaacccaccctccctgccaaacggtaac
ctgagctactacatagtgaggtggcagcggcagcctcaggacagctacctttaccggcac
aattactgctccaaagacaaaatccctatcaggaagtacgccgacggcaccatcgatgtt
gaggaggtgacagagaatcccaagaccgaggtgtgtggtggagagaaagggccttgctgc
gcctgccccaaaactgaggctgagaagcaggccgagaaggaggaggccgagtaccggaag
gtctttgagaatttcctgcacaactccatcttcgtgcccagacctgagaggaagcggagg
gatgtcatgcaagttgccaaccccaccatgtccagccggagcaggaacactacgatggca
gatacctacaacgtcacagacccagaagagctcgagacggagttcccattctttgagagc
agagtggataacaaggagagaaccgtcatttccaacctgcgacctttcacactgtaccgc
atcgatattcacagctgcaatcacgaggctgagaagctgggctgcagcgcctccaacttc
gtctttgcaaggaccatgccagcagaaggagcagatgacattcctgggccagtgacctgg
gagtcaaggcctgaaaactccatctttctaaagtggccagaaccagagaatcccaatgga
ttgatcctaatgtatgaaataaaatatggatcacaagtcgaggatcagcgggagtgtgtt
tccagacaggagtaccggaagtatggaggggccaagcttaaccggctaaacccagggaac
tacacagcccggattcaggccacttccctttctgggaacgggtcgtggacagagcctgtg
ttcttctacgtaccgaccaaaataagaccgtatgaaaacttcatccatctgatcatctcc
gtgcccgtggctgccctgttgatagtgggagggctggttataatgctatacgtcttccac
aggaagagaaataacagcaggctggggaatggagtgctgtacgcctctgtgaacccagaa
tacttcagcgcagctgacgtgtatgtcccagatgagtgggaagtggcccgagagaagatc
actatgagccgagagcttgggcaggggtcgtttggaatggtgtatgaaggagttgccaag
ggtgtcgtcaaagatgagcctgaaaccagggtggccattaaaacggtgaatgaggctgcg
agcatgcgagaaaggattgaatttctcaacgaggcttcagtgatgaaggagttcaattgt
caccatgtggtgcggttgttgggcgtggtgtcccagggccagccaacgctggtcatcatg
gaactgatgacacggggggatctcaaaagttacctcaggtctctgaggccagaaatggag
aataatccagccctagcacctccaagcctaagcaagatgattcagatggcgggcgagatt
gcggatggcatggcatacctcaacgctaacaagttcgttcacagagacctggccgcccgg
aactgcatggtggctgaagacttcacagtcaaaatcggagattttggcatgacgagagat
atttatgagacagactattaccggaaaggagggaaagggctgctgcctgtgcgctggatg
tctcccgagtcgctcaaggatggagtcttcaccacgcattctgacgtctggtccttcggg
gtggtcctctgggagatcgccacattggccgagcagccataccagggcttatccaacgag
caagtccttcgctttgtcatggaaggcggacttctggacaagccagacaactgcccagac
atgctgtttgagctgatgcgcatgtgctggcagtacaaccccaagatgaggccctccttc
ctggagatcatcggcagcgtcaaggacgagatggagcccggcttccgggaggtctccttc
tactacagcgaggagaacaagccgcccgagccggaggagctggacctggagccggagaac
atggagagtgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgacaga
cactcgggacacaaggctgagaacggcccgggtcccggtgtgctggttctccgagccagc
ttcgacgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggccttg
cccctgccccagtcttcaacctgctga

DBGET integrated database retrieval system