KEGG   Loxodonta africana (African savanna elephant): 100655176
Entry
100655176         CDS       T04351                                 

Gene name
CACNA1A
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent P/Q-type calcium channel subunit alpha-1A
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04724  Glutamatergic synapse
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04730  Long-term depression
lav04742  Taste transduction
lav04930  Type II diabetes mellitus
lav05017  Spinocerebellar ataxia
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100655176 (CACNA1A)
   04020 Calcium signaling pathway
    100655176 (CACNA1A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100655176 (CACNA1A)
   04727 GABAergic synapse
    100655176 (CACNA1A)
   04725 Cholinergic synapse
    100655176 (CACNA1A)
   04728 Dopaminergic synapse
    100655176 (CACNA1A)
   04726 Serotonergic synapse
    100655176 (CACNA1A)
   04730 Long-term depression
    100655176 (CACNA1A)
   04723 Retrograde endocannabinoid signaling
    100655176 (CACNA1A)
   04721 Synaptic vesicle cycle
    100655176 (CACNA1A)
  09157 Sensory system
   04742 Taste transduction
    100655176 (CACNA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100655176 (CACNA1A)
  09165 Substance dependence
   05032 Morphine addiction
    100655176 (CACNA1A)
   05033 Nicotine addiction
    100655176 (CACNA1A)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100655176 (CACNA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100655176 (CACNA1A)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100655176 (CACNA1A)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100655176
NCBI-ProteinID: XP_023408094
LinkDB
Position
Unknown
AA seq 2165 aa
MEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVENRRAF
LKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGALRRATIKKSKTDLLNP
EEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSL
VALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDC
GVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIIS
LLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYD
GIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAANQ
KLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKTTKSVWEQRTSEMRKQNLLASREALYN
ELDPDERWKASYARHLRPDMKTHLDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAE
DFLRKQARYHDRTRDPSAQXGLDARRPWAGSQETELGREGPYGRESDHHTREGLEQPGFW
EGEAERGQGCGPPTGRHPSPAGAQQRRAAAAPPRTGADGGVPAGHRPHRRPGXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXARAMRERERTAWPRTYDTEARRDDKERRHRRRKE
NQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESVNPHDSLGHSGLP
QSPAKMGNSTDPEPVPPPPTMATNPQNAASRRMPNNPGNPSNPGPPKTPENSLIVTNPSS
TQTNSAKTARKPDHTAVDIPPACPAPLNHTVVQVNKNANPDPLPKKEEEKKEEEEDDPGE
DGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFDMCILMVIAMSSIALAAEDPVQPNAP
RNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTG
NSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFA
VVAVQLFKGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLT
LFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIII
TFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTI
MAMIALNTIVLMMKFYGASLAYENALRVFNIVFTSLFSLECVLKVLAFGILNYFRDAWNI
FDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKAL
PYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALMLLFRS
ATGEAWHNIMLSCLSGKPCDKNSGILTPDCGNEFAYFYFVSFIFLCSFLMLNLFVAVIMD
NFEYLTRDSSILGPHHLDEYVRVWAEYDPAAWGRMPYPDMYQMLRHMSPPLGLGKKCPAR
VAYQRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWP
NLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLMFQRME
PPSPTQEGGPGQNALPSTQLDPGGGLMAHEGGIKESPSWVTQRAQEMFQKTGTWSPERGP
PTDMPNSQPNSQSVRCERWAGDGYSDSEHYXPMEGQARAASMPPYMLSPQTISDTSPMKR
SASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRGHRASERSLGRYTDVDTGLGTDLSM
TTQSGDLPSKDRDQERGRPKDRKHRQHHHHHHHHPPPPDKERYSQERPDHSRARARDQRW
SRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQTPSTPRPHVSYSPVIRK
AGALGPPQQQQQVARPGRAATSGPRRYPGPAAEPLAGEWPPTGGRGSSRSPGMERRALGP
ARSESPRSCRHTRWPAPRPHTSEGPPGPRHHGYYHDYDEADGLGGRREEGGAYDTPPPAR
HTSSGAGRSPRTPRAAGPDCASPSRHGRRLPNGYYPAQGLPRPRXPGSRKGLHEPYSETD
EDDWC
NT seq 6498 nt   +upstreamnt  +downstreamnt
atggaagggtggactgatctcctgtacaatagcaacgatgcctcagggaacacttggaac
tggttgtacttcatccctctcatcatcattggctccttttttatgctgaacctcgtgctg
ggtgtgctgtcaggggagtttgccaaagaaagggagcgggtggagaaccggcgggctttt
ctgaagctgaggcggcagcagcagattgaaagagagctcaatgggtacatggagtggatc
tcgaaagcagaagaggtgatcctcgccgaggacgaaaccgacggagagcagaggcatccc
tttgatggagctctgcggagagccaccataaagaaaagcaagacagacctgctcaaccct
gaagaggctgaagatcagctggccgatatcgcctctgtggggtctcctttcgctcgagcc
agcattaaaagtgccaagctggagaactcgactttttttcacaaaaaggagaggaggatg
cgtttctacatccgccgcatggtcaaaactcaggccttctactggactgtgctcagtctg
gtagccctcaacacgctgtgtgttgctatcgttcactacaaccagcccgagtggctctcc
gacttcctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttata
aaaatgtatgggctcgggacgcggccttacttccactcttccttcaactgctttgactgt
ggggttatcatcgggagcatcttcgaggtcatctgggccgtcataaaacctggcacatcc
tttggaatcagcgtgttacgagctctcaggttattgcgtattttcaaagtcacaaagtac
tgggcgtctctcaggaacctggtcgtctctcttctcaactccatgaaatccatcatcagc
ctgttgttcctccttttcctctttattgtagtcttcgcccttttgggaatgcagctcttt
ggcggccagtttaattttgatgaaggaacgcctcctaccaactttgacacttttccagca
gcaataatgacggtgtttcagatcctgacaggcgaggactggaacgaggttatgtatgac
ggcatcaagtcccaggggggcgtgcagggcggcatggtgttttccatctacttcatcgtg
ctgacgctcttcgggaactacaccctcctgaatgtgttcttggccatcgccgtggacaac
ctggccaacgcccaggagctcaccaaggatgaacaagaagaagaagaggcagccaaccaa
aaacttgccctacagaaagccaaggaggtggcagaagtgagtcctctgtccgcagccaac
atgtccatagctgtgaaagaacaacagaagaatcagaagacgaccaagtccgtgtgggaa
cagcggaccagcgagatgcggaagcagaacctgctggccagccgggaggccctgtacaac
gagctggatcccgatgagcgctggaaggcctcctacgcccggcacttgcggcctgacatg
aagacgcacttggaccggccgctggtagttgacccccaggagaaccgcaacaacaacacc
aacaagagccgggcagccgagcccacggtggaccagcgcctcggccagcagcgtgccgag
gacttcctcaggaaacaggcccgctaccacgaccggacccgggaccccagcgcccagngg
ggcctggacgcccggaggccctgggctggcagccaggagaccgagctgggccgggagggt
ccttatggccgcgagtcggaccaccacacccgggagggcctagagcagccggggttctgg
gagggcgaggctgagcggggccaaggctgcggaccccccaccgggaggcacccctcaccg
gcaggggcccagcagagaagagccgcagcagctccgccccgcacaggggctgacggggga
gtccccgcaggccaccggccccaccggaggccaggggannnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnngcgagggccatgcgagagcgagagcgcacggcatggcctcgc
acatatgacacagaagcccggagggatgacaaggagcggcggcatcggcggaggaaagag
aaccagggctccggggtccctgtgtcgggccccaacctgtcgaccacccggccgatccag
caagacctgggccgccaagacccgccgctggctgaggacattgacaacatgaagaacaac
aagctggccaccgcagagtccgtcaatccccatgacagccttggccactccggcctgccc
cagagtccagccaagatgggtaacagcaccgaccctgagcccgtgccacccccgcccacc
atggccaccaacccccagaacgccgccagccgccggatgcccaacaacccggggaacccg
tccaaccccggcccccccaagacccccgagaacagccttatcgtcaccaaccccagcagc
acccagaccaactcagctaagactgccagaaagcccgaccacaccgcggtggacatcccc
cctgcctgcccggcccccctcaaccacactgttgtccaagtgaacaaaaacgccaaccca
gacccactgccaaaaaaggaggaagagaagaaggaggaggaggaagacgaccccggggaa
gatggccctaagcccatgcccccctacagctccatgtttatcctgtccacgaccaacccc
cttcgccgcctgtgccattacatcctaaatctgcgctacttcgatatgtgcatccttatg
gtcatcgccatgagcagcatcgccctggccgccgaggaccccgtgcagcccaacgcgcca
cggaacaatgtgctgcggtattttgactacgtttttacaggcgtctttacgtttgagatg
gtgatcaagatgatcgacctggggctcgtcctgcaccagggcgcctacttccgcgacctg
tggaacattctcgacttcattgtggtcagtggggccctggtggcctttgccttcactggc
aacagcaaaggaaaggacatcaacacgattaaatccctccgagtcctccgggtgctacga
cctcttaaaaccatcaagcggttgccaaagctcaaggccgtgtttgactgtgtggtgaac
tccctgaagaatgtcttcaacatcctcatcgtctacatgcttttcatgttcatcttcgcc
gtggtggccgtgcagctcttcaaggggaagttcttccactgcacggatgaatccaaggag
ttcgagaaagactgccgcggcaagtatctcctctatgagaagaacgaggtgaaagcccgg
gaccgagagtggaagaagtatgagttccattacgacaacgtgctgtgggctctgctgacc
ctcttcaccgtgtccacaggggaaggctggccacaggtcctcaagcactcggtggatgcc
accttcgagaaccagggccccagccccgggtaccgcatggagatgtccatcttctatgtc
gtctactttgtggtgttccccttcttctttgtcaacattttcgtggccttgatcatcatc
accttccaggagcagggggacaagatgatggaggaatacagcctggagaaaaatgagagg
gcctgcatcgactttgccatcagcgccaagccgctgacgcgccacatgcctcagaacaag
cagagtttccagtaccgcatgtggcagttcgtggtgtccccacccttcgagtacaccatc
atggccatgatcgccctcaacactatcgtgctcatgatgaagttctacggggcctcgctt
gcttatgaaaacgctctaagagtgttcaacatcgtcttcacctccctcttctctctggaa
tgtgtgctgaaagtcttggcttttgggattctgaattatttccgcgatgcctggaacatc
ttcgactttgtgactgttctgggcagcatcaccgacatcctcgtgactgagtttgggaat
aacttcatcaatctgagcttcctccgcctcttccgagctgcccggctcatcaaactcctt
cgtcagggttacaccatccgcattcttctctggacctttgtgcagtccttcaaggccctg
ccgtatgtctgtctgttgattgccatgcttttcttcatctacgccatcatcggaatgcag
gtgtttggcaacattggcattgacgtggaggacgaggacagtgatgaagatgagttccaa
atcactgagcataataacttccggaccttcttccaggccctcatgcttctcttccggagc
gccaccggggaggcttggcacaacatcatgctgtcctgccttagcgggaagccatgtgat
aaaaactctggcatcctgactcccgactgtggcaacgaattcgcgtatttttacttcgtt
tccttcatcttcctctgctcgtttctgatgctgaacctctttgtcgccgtcatcatggac
aacttcgagtacctcacccgcgactcctccatcctgggccctcaccacctggatgagtac
gtgcgtgtctgggctgagtacgaccccgcagcttggggccgcatgccctacccggacatg
tatcagatgctgagacacatgtctccgcccctgggtctggggaagaagtgtccggccaga
gtggcctaccagaggcttctgcggatggacctgccggtcgctgatgacaacaccgtccac
ttcaattccaccctcatggcactgatccgaacggccctagacatcaagattgccaagggt
ggagctgacaagcagcagatggatgctgagctacggaaggagatgatggccatttggccc
aacctgtcccagaagacactggacctgctggtcacacctcataagtccacggacctgacg
gtggggaagatctacgccgccatgatgatcatggagtactaccggcaaagcaaggccaag
aagctacaggccatgcgcgaggagcagaaccggacacccctcatgttccagcgcatggag
cccccatctccgacgcaggagggtgggcctggccagaatgccctcccctccactcagctg
gacccaggaggaggcctgatggcccatgaaggtggcatcaaggagagcccatcctgggtg
acccagcgggcccaggagatgttccagaagacgggcacatggagcccggagcgggggcca
cccaccgacatgcccaacagccagcccaactctcagtctgtgagatgcgagagatgggca
ggagatggctactccgacagtgagcactacnctcccatggaaggccaggcccgggccgcc
tccatgcccccctatatgctgtccccccagaccatctcagacaccagccccatgaagcgc
tcggcctcagtgctgggccctaaggcccggcgcctggacgattactccctggaacgggtg
ccaccagaggagaaccagcggcaccaccagcggcgccgagaccggggccaccgtgcctcc
gagcgctccctgggccgctacaccgacgtggacacaggcttgggcacagacctgagcatg
accactcagtccggggaccttccatcgaaggatcgagaccaggagcggggccggcccaag
gacaggaagcaccgccagcaccaccaccaccaccaccaccatcccccgccccctgacaag
gagcgctacagccaggagcggcccgaccacagccgggccagggccagggaccagcgctgg
tcccgctcccccagcgagggccgagagcacatggcacaccggcagggcagtagttccgta
agtggaagcccagccccctcaacatctggtaccagcactccgcggcggggacgccgccag
cttccccagaccccctccaccccccggccacacgtgtcctattcccccgtgatccgtaag
gccggcgccttggggcccccacagcaacagcagcaggtggcgcggccaggccgtgcggcc
acgagcggcccacggaggtacccgggccccgcggccgagcctctggccggggagtggccg
cccacggggggccgcggcagcagccgctcgccagggatggagcggcgggccctgggcccg
gcccggagcgagtccccgaggtcctgtcgccacacccggtggccggcaccccgcccgcac
acgtccgaggggcctccagggccccggcaccacggctactaccacgactacgacgaggcc
gacggcctgggcggcaggcgtgaggagggcggggcctacgacacaccaccccccgcgcga
cacacgtcctcgggcgcggggcgctcgcccaggactccccgggccgcgggcccggactgc
gcctcgccttcccggcacggccggcggctccccaacggctattacccggcccaaggactg
cccaggccccgcnggccgggctcccggaaaggcttgcacgaaccctacagcgagaccgac
gaggacgactggtgctaa

KEGG   Loxodonta africana (African savanna elephant): 100660444
Entry
100660444         CDS       T04351                                 

Gene name
CACNA1B
Definition
(RefSeq) voltage-dependent N-type calcium channel subunit alpha-1B
  KO
K04849  voltage-dependent calcium channel N type alpha-1B
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04010  MAPK signaling pathway
lav04020  Calcium signaling pathway
lav04721  Synaptic vesicle cycle
lav04723  Retrograde endocannabinoid signaling
lav04725  Cholinergic synapse
lav04726  Serotonergic synapse
lav04727  GABAergic synapse
lav04728  Dopaminergic synapse
lav04930  Type II diabetes mellitus
lav05016  Huntington disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05032  Morphine addiction
lav05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100660444 (CACNA1B)
   04020 Calcium signaling pathway
    100660444 (CACNA1B)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100660444 (CACNA1B)
   04725 Cholinergic synapse
    100660444 (CACNA1B)
   04728 Dopaminergic synapse
    100660444 (CACNA1B)
   04726 Serotonergic synapse
    100660444 (CACNA1B)
   04723 Retrograde endocannabinoid signaling
    100660444 (CACNA1B)
   04721 Synaptic vesicle cycle
    100660444 (CACNA1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100660444 (CACNA1B)
   05020 Prion disease
    100660444 (CACNA1B)
   05022 Pathways of neurodegeneration - multiple diseases
    100660444 (CACNA1B)
  09165 Substance dependence
   05032 Morphine addiction
    100660444 (CACNA1B)
   05033 Nicotine addiction
    100660444 (CACNA1B)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100660444 (CACNA1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100660444 (CACNA1B)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100660444 (CACNA1B)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 100660444
NCBI-ProteinID: XP_023397659
LinkDB
Position
Unknown
AA seq 2250 aa
MVRFGDELGGRYGGAGGGERARGGGAGGVGGPGPGGLQPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPD
GDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILT
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCEEDMECREYWPGPNFGITNFDNI
LFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDVLKRAA
TKKSRNDLIHAEEGEDRFADLGAIGSPFARASLKSGKNDSSSYFRRKEKMFRFFIRRMVK
AQSFYWAVLCVVALNTLCVAIVHYKQPQRLTIALYFAEFVFLGLFLTEMSLKMYGLGPRS
YFRSSFNCFDFGVIVGSIFEVIWAAIKPGTSFGISVLRALRLLRIFKVTKYWNSLRNLVV
SLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQIL
TGEDWNAVMYHGIESQGGVSKGMFSSFYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
DEEEMEEAANQKLALQKAKEVAEVSPMSAANISIAARQQNSAKARSVWEQRASQLRLQNL
RASCEALYSEMDPEERLHFAATRHLRPDMKTHLDRPLVVEPGREAPREGFESSEPARPPS
GLAAEGPDLSRRHHRHRDKDKTPVPTVAGAEQDRPEAPKAENGELGGREERPRSHRSRSK
EPTGPREGRSERPRGPGLEGSGRRHHRRGSPEEATEKEPRRHHAHRHVLDQAREGTGAKG
ERRARHRGGPRAAPREADSTEEPARRHRARHKVLSKHDSLEKEAVEKESEHLDKDKDRDK
ELRNHQSKELRCEVEASGLLGAGPVHALPSTCLQKVVEQPEDADNQRNVTRMGNQPLEPS
AAVLIPVTLMGPPEENTIVPSENIDLESQAEGKKEADTSGVMGGGPRPIVPYSSMFCLSP
TNLLRRCCHYIVTMRYFEMVILVVIALSSIALAAEDPVRTDSPRNNVLKYMDYIFTGVFT
FEMVIKMIDLGLLLHPGAYFRDLWNILDFIVVSGALVAFAFSGSKGKDINTIKSLRVLRV
LRPLKTIKRLPKLKAVFDCVVNSLKNVLNILVVYMLFMFIFAVIAVQLFKGKFFYCTDES
KELERDCRGQYLDYEKEEVEAQPRQWKKYDFHYDNVLWALLTLFTVSTGEGWPMVLKHSV
DATYEEQGPSPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKN
ERACIDFVISAKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTAVLMMKFYAA
PYEYELMLKCLNIVFTSMFSMECVLKIIAFGVLNYFRDAWNVFDFVTVLGSITDILVTEI
AETNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAI
IGMQVFGNIALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSNRACDEHAN
ASECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAE
YDPAACGRISYNDMFEMLKHMSPPLGLGKKCPARVAYKRLVRMNMPISSEDMTVHFTSTL
MALIRTALEIKLAPGEQDDSEEDPVTTYISALPGSWGGTAGGGHAPPEAPQSRGFPRGGA
HLIHPVLPQCLLFSPADEMTVGKVYAALMIFDFYKQNKTTRDQIHQAPGGLSQMGPVSLF
HPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAVGSHSPPGCPLHTERDTGNAFRIPS
NHSSGLMPSSPAAVVATGYAALGSSAAPSRERRQERGRSQERRQHSSSSSEKQRFYSCDR
FGSREPAPPRPPLGSQPTSPTAAPEPGPHRQGSGSVNGSPLLSTSGASTPGRGGRRQLPQ
TPLTPRPSITYKTANSSPIHFAGVQTSLPAFSPGRLSRGLSEHNTLLQRDPLSQPLAPSS
RIGSDPYLGQRLDSEASRPPPEDTLTFEEAAATNSGRSSRTSYVSSMTSQPHPLRRVPNG
YHCTLGLSVGPTPGGRARHSYHHPDQDDWC
NT seq 6753 nt   +upstreamnt  +downstreamnt
atggtccgcttcggggacgagctgggcggccgctatgggggcgccggcggcggggagcgg
gcccggggcggcggggccggcggggtgggcggcccgggcccggggggactgcagcccggc
cagagggtcctctacaagcagtcgatcgcgcagcgcgcgcggaccatggcgctgtacaac
cccatcccggtcaagcagaactgcttcaccgtcaaccgctcgctcttcgtcttcagcgag
gacaacgtcgtccgcaaatacgccaagcgcatcacggagtggcctccgtttgaatacatg
atcctggccaccatcatcgccaactgcatcgtgctggccctggagcagcacctccctgac
ggggacaagacgcccatgtccgagcgactggacgacacggagccttacttcatcggcatc
ttttgctttgaggcgggcatcaagatcattgccctgggcttcgtcttccacaagggctcc
tacctgcgcaacggctggaatgtcatggactttgtggtggtgctcacagggatcctgacc
acagctggcactgacttcgacctgcggacactgcgagctgtgcgtgtgttaaggcccctg
aagctggtgtctggaattccgagtttgcaggtggtgctcaagtccatcatgaaggctatg
gtcccgctcctgcagattgggctgcttctcttcttcgccatcctcatgtttgccatcatc
ggcctcgagttctacatgggaaaattccataaggcctgtttccccaacagcacagatgca
gagcctgtgggagacttcccctgtggcaaggaggccccggcccggctgtgtgaggaagac
atggagtgccgggagtattggccggggcccaactttggcatcaccaactttgacaacatc
ttgtttgctgtcctgacggtgttccagtgcatcaccatggagggctggactgacatcctc
tacaacaccaatgacgcggctggtaacacctggaactggctctacttcatccccctcatc
atcattggctccttcttcatgctcaacttggtactgggcgtgctctctggagagtttgcc
aaagagcgtgagagggtggagaaccgtcgtgccttcttgaagctccgccgacagcagcag
attgagcgggagctcaatgggtacctagagtggattttcaaggccgaggaggtcatgctg
gctgaggaggacaagaatgcggaggagaaatccccattggatgtgctgaagcgagcggcc
accaagaaaagcaggaacgatctgatccacgctgaggagggtgaggaccgctttgctgac
ctaggcgccatcggttctccctttgctcgcgccagcctcaagagtgggaagaatgacagc
tcctcatattttcggcggaaggagaagatgttccggtttttcatccgccgcatggtgaag
gcgcagagcttctactgggcggtgctgtgtgtggtggctctgaacacactctgtgtggcc
atagtgcactacaaacaacctcagcggcttactatcgctctgtattttgcagagtttgtt
ttcctgggtctcttcctcacagagatgtccctgaagatgtatggcctggggcccagaagc
tacttccggtcctccttcaactgctttgactttggggtcattgtggggagcatttttgaa
gtgatctgggcggccatcaagccaggaacctcctttgggatcagtgtactgcgggcactc
cggctactgagaatcttcaaggtcaccaagtactggaactccttacggaacctggtggtg
tctctgctcaactccatgaagtccatcatcagccttctcttcctgctcttcctgttcatc
gtggtctttgctctgcttgggatgcaactgtttgggggacagttcaacttccaggatgag
actcccacgaccaactttgacaccttccctgccgccatcctcaccgtcttccagatcctg
accggagaggactggaatgcagtgatgtatcacggcatcgaatcacaaggtggagtcagc
aaaggcatgttctcatctttttacttcattgtcctgacgttgtttggaaattacactctg
ctcaacgtcttcctggctattgcagtggacaacctcgccaacgcccaggagctaactaag
gatgaagaggagatggaagaagcagccaatcagaagcttgctctgcaaaaggccaaagaa
gtggctgaagtcagccccatgtctgccgcaaacatctccattgcagcgaggcagcagaac
tcagccaaggcacggtcagtgtgggagcaacgggccagccagctgcggctgcagaacctg
cgggccagctgtgaggcactgtacagtgagatggaccctgaggagcgactgcacttcgcc
gccacacgccacctgcgacctgacatgaagacacacctggatcggcccctagtggtggag
cctggccgtgaggcacctcgggagggctttgagtcctctgagcctgcccgcccgccgtca
ggccttgctgccgagggccctgacctgtcccgacggcaccaccgccaccgtgacaaggat
aagaccccagtccccacagtggccggtgctgagcaggacagacctgaggctcccaaggct
gagaacggggagctggggggccgggaggagcgaccccggtcacaccgcagccgcagcaag
gagcccacaggcccccgagaaggccggagtgagcggccccgaggcccaggccttgagggc
agtggccggcgccaccatcggcgaggctccccagaagaggcaactgagaaggagccccgg
cgtcaccacgcccaccggcacgtgctggaccaggcccgggagggcaccggagccaagggc
gagcggcgagcgcggcaccgcggaggcccccgtgctgcccccagggaggctgatagcacg
gaggaaccggctcggcggcatagggcccggcacaaggtgctgtccaagcatgactctctg
gagaaggaagctgtggagaaggagagtgagcatctggacaaggacaaggacagggacaag
gagctccggaaccaccagtccaaggagctgcgctgtgaagtggaggccagtgggctgctg
ggggcgggccctgtgcatgcactgcccagcacctgtctccagaaggtggtggaacaacca
gaggatgcagacaaccagcggaatgtcacgcggatgggcaatcaacccctggagccaagt
gctgccgtactgatcccagtgacactgatgggccccccagaggagaacaccattgtgccc
agtgaaaacatagacctggagagccaagcggaggggaagaaggaggcagataccagcggt
gtgatgggaggcggcccccggccaattgtcccatacagctccatgttctgtctgagtccc
actaacctgctccgccgctgctgccattacattgtgaccatgcggtacttcgagatggtc
attctggtggtcattgccctgagcagcattgccctcgctgctgaggaccctgtgcgcaca
gactcacccaggaacaacgttctgaaatacatggattacatcttcacaggcgtcttcacc
tttgagatggtgataaagatgattgacctgggactgctgctacaccctggggcctacttc
cgggacctgtggaacatcttggacttcattgtggtcagtggtgctctggtggcatttgcc
ttctcaggatccaaagggaaagacatcaacactatcaagtccctgagagtcctgcgtgtc
ttgcggccactcaagaccatcaaacggctgcctaagctcaaggccgtgttcgactgtgtg
gtgaactccctgaagaacgtcctcaacatcctggtcgtctacatgctcttcatgttcatc
ttcgctgtgatcgccgtgcagctcttcaaagggaagttcttttactgcactgacgagtcc
aaggagctggagagggactgcaggggtcagtatctggattatgaaaaggaggaagtggaa
gctcaaccgcggcagtggaagaaatatgactttcactatgacaatgtgctctgggctctg
ctgacactgttcactgtgtctacaggagaagggtggcccatggtactgaaacactccgtg
gatgccacatacgaggagcagggcccgagccctgggtaccgcatggagctgtccatcttc
tatgtggtctactttgtggtctttcccttctttttcgtcaacatttttgtggccttgatc
atcatcaccttccaggagcagggggacaaggtgatgtccgagtgcagcctggagaagaat
gagagggcctgcattgacttcgtcatcagtgccaagcccctgactcggtacatgcctcaa
aacaagcagtcattccagtataagacgtggacgttcgtggtgtccccacccttcgagtac
ttcatcatggccatgattgccctcaacaccgccgtgttgatgatgaagttttacgccgca
ccctatgagtatgagttgatgctgaagtgcctgaacatagtgttcacgtccatgttctcc
atggagtgtgtgctgaagatcatcgcctttggggtgttgaactatttcagagatgcctgg
aacgtcttcgactttgtcactgtgttgggaagtattactgatattttagtaacagagatt
gcggaaactaacaacttcatcaacctcagcttcctccgcctgtttcgtgctgcccgcctc
atcaagctgctccgtcaggggtataccatccgcatactgctgtggaccttcgtccagtcc
ttcaaggccctgccgtatgtgtgtctgctcatcgccatgctcttcttcatctatgccatc
atcggcatgcaggtgtttggaaacatcgccctagatgatgacacaagcatcaaccggcac
aataacttccgaacctttctacaagccttgatgctgctgttcaggagcgccacaggggag
gcctggcacgagatcatgctgtcttgtctaagcaaccgtgcctgtgatgagcacgccaat
gccagtgagtgtgggagtgactttgcctacttttacttcgtctccttcatctttctttgt
tcctttctgatgttgaacctctttgtggctgtgatcatggacaattttgagtaccttacg
cgggactcttccatcctagggcctcaccacctggacgagttcatccgggtctgggctgag
tacgacccggctgcctgtgggcgcatcagttacaatgacatgtttgagatgttgaagcac
atgtccccacctctgggcctggggaagaaatgccccgctcgtgttgcgtataagcgcctg
gtacgcatgaacatgcccatctccagtgaggacatgacagtccacttcacgtctactctg
atggccctcatcaggactgcactggagatcaagctggctccaggtgagcaagatgacagt
gaggaggatcctgtaaccacctatatatctgcactaccaggtagctggggtgggacagct
gggggaggccatgctcctcctgaggcccctcagtccaggggctttccaagaggtggggct
catctcatccaccccgttctgccccaatgcctgcttttttctccagctgatgagatgaca
gtggggaaagtctacgcagctctgatgatatttgacttctacaaacagaacaaaaccacc
agagaccagattcaccaagctcctggaggcctgtcccagatgggccccgtgtccctgttt
caccctctgaaagccactttggagcagacacagccagctgtgctccgaggagccagagtt
ttccttcggcagaagagctccacgtccctcagcaacggtggggctgtgggcagccactcc
cccccaggctgccctctgcacacagagagagatactggcaatgctttcaggatccccagc
aaccactcatctggtctcatgcccagctctccagctgctgtggtcgccacaggatatgcg
gccctgggcagctcagcagcgcccagccgggagcgaaggcaggagcgaggccgctcacag
gagcgcaggcagcattcctcctcatcctcagagaagcagcgcttctactcctgcgaccgc
tttggcagccgtgagcctgcaccacccaggcccccgcttggcagccaacccacatcaccc
accgccgcaccggagccagggcctcacagacagggtagtggttcagttaatgggagcccc
ttgctgtcaacatctggtgctagcaccccaggccgaggtgggcggaggcagctcccccag
acccccctgaccccccgacccagcatcacctacaagactgccaactcctcacccattcac
ttcgccggggtccagaccagcctccctgccttctcccctggccggctcagccgaggcctc
tccgagcacaacacactgctccagagagaccccctcagccagccactggcacccagctct
cgaattggctccgacccatatctggggcagcgcctggacagcgaggcctcccggcccccg
ccggaagacacgctcaccttcgaggaggccgcggccaccaactcgggccgctcctccagg
acttcctacgtgtcctcgatgacctcccagccacatcccctccgccgtgtgcccaatggc
taccactgcacgctggggctcagcgtgggccccacaccaggcggccgggcacggcacagc
taccaccaccccgaccaagacgactggtgctag

DBGET integrated database retrieval system