KEGG   Loxodonta africana (African savanna elephant): 100655246
Entry
100655246         CDS       T04351                                 

Gene name
SLC34A3
Definition
(RefSeq) sodium-dependent phosphate transport protein 2C
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100655246 (SLC34A3)
  09154 Digestive system
   04978 Mineral absorption
    100655246 (SLC34A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100655246 (SLC34A3)
   04147 Exosome [BR:lav04147]
    100655246 (SLC34A3)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   100655246 (SLC34A3)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100655246 (SLC34A3)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 100655246
NCBI-ProteinID: XP_023398424
LinkDB
Position
Unknown
AA seq 525 aa
MTSPLTGSQVPHPALDTVDLVDWSLENAEASGSALALEEGDTDPWALPQLKDTGQSWKEL
SVTGRVRWVVGGILKASGLLGNLYLFICSLDTLSSAFQLLGSKVAGDIFKDNQVLANPVA
GLVIGVLVTVLVQSSSTSSSIVVSMVASKLLTIQASVPIIMGVNVGTSVTSTLVSLAQSG
DMGEFRRAFGGSAVHGIFNWLTVLILLPLESAAAVLERLSALALGATSLQPGARAPDILK
VLTQPITHLIIQVRTLLPWPGGPTCPVMLEERGGGGDPDPARDGGRQRGPDFPFPFGWLS
GYLAILVGAGLTFVVQSSSVFTAAVVPLMGVGVISMERAYPLFLGSNIGTTTTALLAALA
TPSNMLLSAVQVALIHFLFNLAGILLWYVVPALRLPIPVAKRFGDLTARYRWVAIAYLLL
SFLLLPLAAFGLSLAGSTVLAAVGGPVAGLLLLVVLVNVLQCHRPTWLPRCLRSWAWLPH
WLHSLEPWDGLVTHCCPCQACSAPHATTKKAHCYENPEVLASQHL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgacgagtcccctcactggcagtcaggtcccccaccctgctctggacacggttgacctg
gtggactggagtctggagaatgcagaggcctctggttctgccttggccctggaggagggg
gacacagacccctgggccctccctcagctgaaggacactggccagtcctggaaagagctc
agcgtgactggcagagtgcgctgggtggtcggaggcatcctcaaggcctctggcctcctg
ggcaacctgtacctcttcatctgctccctggacaccctcagctctgccttccagcttctg
ggcagcaaagtggctggagacatcttcaaggacaaccaggtgctggccaaccccgtggct
ggcctggtcatcggcgtgctggtcaccgtcctggtgcagagctccagcacatcatcctcc
atcgtggtcagcatggtggcctccaagctgctgaccatccaggcctcggtgcccatcatc
atgggcgtcaacgtgggtacatccgtcaccagcaccttggtctcattggcgcagtccggg
gacatgggtgagttccgcagggcctttggtggctcagctgtgcatggcatcttcaactgg
ctgacggtgctgatcctgctgcctctggagagtgcagcggctgtgctggagaggctgagc
gcactggccctgggtgccaccagcctgcagcctggggcacgtgcgcctgacatcctcaag
gtgctgacacagccgatcacacaccttatcattcaggtgaggacactgctgccctggcca
ggtggtcccacatgccccgtcatgctggaggagaggggaggaggtggagacccagaccct
gcccgagatggagggagacagaggggaccagacttccccttcccgttcggctggctcagt
ggctacctggccatcctggtgggcgctggcctgacctttgtggtccagagcagcagcgtc
ttcacagccgccgtcgtgccactgatgggggtcggggtgatcagcatggagcgggcctac
cccctctttctgggctccaacattggcaccaccaccacggccctgctggctgccctggcc
accccctccaacatgctgctcagcgccgtccaggtggccctcatccacttcctcttcaat
ctggccggcatcctgctgtggtacgtggtgcccgccctgcggctgcccatcccagtggcc
aagcgcttcggtgacctgaccgcccgttaccgttgggtggccattgcctacctgctgctc
agcttcctgctgctgcccctggcggcctttgggctctccctggcgggcagcacggtgctg
gctgcggtcggggggcccgtggcggggctactgctcctggtcgttctagtcaatgttttg
cagtgccaccggccaacctggctgccccgttgcctgcggtcctgggcctggctcccccac
tggctgcactccctggagccctgggacggcctggtcacccactgctgtccctgccaggcc
tgcagtgcccctcacgccaccacaaaaaaggctcactgctatgagaaccccgaggtcctg
gcctcccagcatctgtaa

KEGG   Loxodonta africana (African savanna elephant): 100656404
Entry
100656404         CDS       T04351                                 

Definition
(RefSeq) sodium-dependent phosphate transport protein 2B-like
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100656404
  09154 Digestive system
   04978 Mineral absorption
    100656404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100656404
   04147 Exosome [BR:lav04147]
    100656404
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   100656404
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100656404
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 100656404
NCBI-ProteinID: XP_003411343
LinkDB
Position
Unknown
AA seq 694 aa
MAFKIRFRTTMASWPELENVHADPNKCIEGATSQQSATPAKGEEAAKNASVSPVTEMDLS
SFNTVPVNDASTEVEDPWDLPVLQDTGIKWSERDIKGKILCIFQGIGKFILLLGFLYLFV
CSLDVLSSAFQLAGGKVAGKFLSDNVMLSNPVVGLVIGVLVTAMVQSSSTSSSIIVSMVA
ASLLTVRAAIPIIMGANIGTTITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVFVLL
PLESATHYLEVLTNFVVETFHFKNGEDTPDLLKVITDPFTKLIIQLDKKVIKHIAMKDET
AQNKSMVKIWCHTFTNMTEMNVTVPSPENCTSPSLCFTDGFQFWTMKNVTYKENIAKCQH
IFVNFNLPDIAIGAILLIISLLLLCTCLVMIVKLLNSVLKGQVAIVIKKTLNTDFPFPFA
WLTGYLAIIVGAGMTFLMQSSSVFTSAMTPLIGVGVITIERAYPLTLGSNIGTTTTAILA
ALASPGNTLKSSLQIALCHFFFNVSGILLWYPIPIIRLPIHLAKGLGNICAEYRWFAIFY
VVFLFFLVPLTVFGLSLAGWQVLVGVGVPIILLLILVVFIRLLQSHCPRVLPHKLQNWNF
LPLWMHSLKPWDHLISLLTRCCQRHCCCCRVCCLLCGCPKSCEDLEEGQEHSKDIPIKAS
YAFDNVAMSKKAQDKVKFQVNILGTKTISSSTVF
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggcattcaaaattaggttcagaaccacaatggcttcttggcctgagttggaaaatgtc
catgcagaccccaataaatgcattgaaggggccactagtcagcagtccgccacgcctgca
aaaggtgaagaggccgctaaaaatgcctccgtgagtcctgtaactgagatggatctgtct
tctttcaacaccgtgccagtcaacgatgcatccacagaggtggaagacccctgggacctg
cctgtacttcaggacacggggatcaagtggtcagagagagacatcaaagggaagattcta
tgtatattccaagggattgggaaattcattttacttctgggatttctctacttgttcgtg
tgctccttggatgtcctcagcagtgcctttcagctggctggaggaaaggtggctggcaag
ttcctcagtgacaacgtcatgctctctaaccctgtggtggggctggtgattggagtcctg
gtgaccgccatggtgcaaagctctagcacctcctcatccatcatcgtcagcatggttgct
gcctcactgttgacggtgcgggctgccatccccatcatcatgggggccaacatcggaacc
actattaccaacaccatcgtggcgctcatgcaggcaggagaccggaacgagttccgaagg
gcttttgcaggggccaccgtccatgacttcttcaactggctctcggtgtttgtgctcttg
cccctggagtctgccacccattacctggaggtcctgaccaactttgtggtggagaccttc
cacttcaagaatggtgaagacaccccagatcttctgaaagtcatcacagatccctttaca
aagctcattatccagctggataaaaaagttatcaaacacattgcgatgaaggatgaaaca
gcccaaaacaagagtatggtcaagatttggtgtcacactttcaccaatatgactgagatg
aatgtcaccgtcccttcacccgagaactgcacttccccttccctctgtttcacggatggt
ttccaattctggaccatgaagaacgtgacctacaaggaaaacatcgccaaatgtcagcac
atctttgtgaatttcaacctcccggatattgccattggtgctatcttgctgataatctcc
ctgctgctcctctgcacctgcctggtcatgattgtaaaactcctcaactccgtgctcaag
ggacaggttgctattgtcatcaagaaaaccctcaacactgatttcccctttccctttgcc
tggttgactggctacctagccatcattgtgggagcaggaatgaccttcctcatgcagagc
agctccgtattcacatcggccatgaccccactgattggcgttggtgtgataaccattgag
agggcatacccactcacactgggctccaacattggcaccaccaccactgccatcctggct
gccttagccagcccaggcaataccttgaagagttcacttcagattgccttgtgccacttc
ttcttcaacgtctctggcatcttgctgtggtacccgatcccgatcatccgcctgcctatc
cacctggccaaggggctgggcaacatttgtgctgagtaccgttggttcgccatcttctac
gtggtcttcttattcttcctcgtcccgctgacagtgtttggcctctcactggctggctgg
caagtgctggtgggtgtgggtgtgcccatcatcctcctgctgatcctggtggtgttcatc
cggctcctgcagtcccactgcccacgtgtcctaccccacaaactccagaactggaacttc
ctgcccctgtggatgcactcgctgaagccctgggaccacctcatctccctgctcaccagg
tgctgccagaggcactgctgctgctgtcgtgtgtgttgcctgctgtgtggctgccccaag
agctgtgaggacctggaggaggggcaggagcactctaaagacatccccatcaaggcctcc
tatgccttcgataacgtggccatgagtaaaaaggcccaggataaggtcaagttccaagtt
aatatcctgggtacgaagaccatctccagcagcacagtcttttag

KEGG   Loxodonta africana (African savanna elephant): 100666257
Entry
100666257         CDS       T04351                                 

Definition
(RefSeq) sodium-dependent phosphate transport protein 2B-like
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100666257
  09154 Digestive system
   04978 Mineral absorption
    100666257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100666257
   04147 Exosome [BR:lav04147]
    100666257
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   100666257
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100666257
SSDB
Motif
Pfam: Na_Pi_cotrans DUF4714
Other DBs
NCBI-GeneID: 100666257
NCBI-ProteinID: XP_003411428
LinkDB
Position
Unknown
AA seq 692 aa
MAPWPELENAQPDPNKHVEGVTNQQSTTPAKGEKATKSASGSPVTKMELLPSYSTMALIE
DPSEVVDPWDMPALKDTGIKWSERDAKGKILCIFQGIGKFILLLGFLYLFVCSLDILSSA
FQLVGGKVAGQFFSDNAILSNPVAGLVIGVLVTVLVQSSSTSSSIIVSMVASSLLTVRAA
IPIIMGANIGTSITNTIVAFMQAGDRNEFRRAFAGATVHDFFNWLSVFVLLPLEAASHYL
EILTNLVVDSFQLQNGEDAPELLKVITDPFTKLIIQLDNKVINQIAMKDETAQNKSLVKI
WCQTFTNVTEKNVTVSLRKNGTSLSPRFTDDVQSWTMENVTYTENIAKCQHIFVNSNLPD
VAIGAILLIISLLVLCACLVMIVKLLNSVLKGQVAVVIKKTLNTDFPFPFAWLTGYLAIL
VGAGMTFIVQSSSVFTSAMTPLIGIGVITIERAYPLTLGSNIGTTTTSILAALASPGNTL
KSSLQIALCHFFFNVSGILLWYPIPFTRLPIRLARGLGNISAKYRWFAIFYLVFLFLLLP
LIVFGLSLAGWQVLVGVGVPIIFLLLLVVFMRLLQSRCPRVLPHKLRNWNFLPLWMHSLK
PWDYLVSLLTSFCQTRCCCCCRVCCKLCGCPRCCRCSRCCEDLEEGQEDSKDIPIKAPYA
FDNMAMSREAQDEVKSQVDTMDMKNTPSSTAF
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggctccttggcctgagttggagaatgcccagccagaccccaataaacacgttgaaggg
gtcactaatcagcagtccacaacacctgcgaaaggtgaaaaggccactaaaagtgcctct
ggaagccctgtaaccaagatggaacttctgccttcatattctactatggcactgattgaa
gatccgtcagaggtggtagacccatgggacatgcctgcacttaaggacacggggatcaag
tggtcagagagagacgccaaaggaaagattctatgtatattccaagggattgggaaattc
attttacttctgggatttctctacctgttcgtgtgctccttggatattctcagcagtgcc
tttcagctggttggaggaaaggtggctggacagttcttcagtgacaacgctatcctgtcc
aaccctgtggcagggctggtgatcggggtgctggtgaccgtcttggtgcagagctccagc
acctcctcatccatcatcgtcagcatggtggcctcctcactgttgacggtgcgggctgcc
atccccatcatcatgggggccaacattggaacttccatcaccaacaccattgtggcgttc
atgcaggcaggcgaccggaatgagttccgaagggcttttgcgggggccactgtccacgac
ttcttcaactggctgtccgtgttcgtgcttttgcccctggaggctgcctcccattacctg
gagatcctgaccaaccttgtggtggacagcttccagctccagaatggcgaagatgcccca
gaacttctgaaagtcatcacagatcccttcacaaagctcattatccagctggataacaaa
gttatcaaccaaattgcgatgaaggatgaaacagcccaaaacaagagtctggtcaagatt
tggtgccagacttttactaatgtgactgagaagaatgtcaccgtctccttgcgcaagaac
ggcacctccctttccccgcgtttcacggatgatgtccaatcctggaccatggagaatgtg
acctacactgagaacatcgccaaatgtcagcacatctttgtgaattccaacctcccagat
gttgccattggtgctatcttgctgataatctccctgctggtcctctgcgcctgcctggtc
atgattgtaaaactcctcaactccgtgctcaaggggcaggtcgctgttgtcatcaagaag
accctcaatactgatttcccctttccctttgcctggttgactggctacctggccatcctt
gtgggggcgggaatgaccttcattgtgcagagcagctctgtgttcacgtctgccatgacc
ccgctgattggcatcggtgtgataaccattgagagggcatacccactcacactgggctcc
aacattggcaccaccaccacttccatcctggctgccttagccagcccaggcaataccttg
aagagttcactccagattgccctgtgccacttcttcttcaatgtctccggcatcttgctc
tggtacccgatcccgttcacccgcctgcctatccgcctagccaggggcctgggcaacatc
tctgccaagtaccgttggttcgccatcttctacctggtcttcttattcctcctcctccca
ctgatagtatttggcctctcactggctggctggcaagtgctggtgggtgtaggtgtgccc
atcatcttcctgctgctcctggtggtgttcatgcggctcctgcagtcccgctgcccacgt
gtcctgccccacaagctccggaactggaacttcctgcccctgtggatgcactcactgaag
ccctgggactacctcgtctccctgcttaccagcttctgccagacgcgctgctgctgctgc
tgccgtgtgtgttgcaagctgtgtggctgtcccaggtgctgccgctgcagcagatgctgt
gaggacctggaggaggggcaggaggactctaaagatatccccatcaaggccccctatgcc
ttcgataacatggccatgagcagagaggcccaggatgaggtcaagtcccaagttgatacc
atggatatgaaaaacacccccagcagcacagccttttag

KEGG   Loxodonta africana (African savanna elephant): 100673627
Entry
100673627         CDS       T04351                                 

Gene name
SLC34A1
Definition
(RefSeq) sodium-dependent phosphate transport protein 2A
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100673627 (SLC34A1)
  09154 Digestive system
   04978 Mineral absorption
    100673627 (SLC34A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100673627 (SLC34A1)
   04147 Exosome [BR:lav04147]
    100673627 (SLC34A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   100673627 (SLC34A1)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100673627 (SLC34A1)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 100673627
NCBI-ProteinID: XP_003404736
UniProt: G3T4Y8
LinkDB
Position
Unknown
AA seq 639 aa
MMSYGERLGSPAVSPLPVRGGHVMHGAAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
SCPYGEVLELHDPLPAKPALEEEQKPEPGLAQRLRQASTTLLKVPLMLAFLYLFVCSLDV
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHVTRLVVASFNICGGRDAPDLLKIITEPFTKLIIQLDKSVITSIATGDESLRNHS
LIRTWCHPDLLEAHTSTPSVEANSSWHLGNATMEKCNHIFVDTGLPDLAVGLILLAGSLV
LLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPVPFTWVTGYFAMVVGAGMTFVVQSSS
VFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLPSAFQIALCHFFF
NISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQA
MVGVGAPFGALLAFMGLVSFLQSRSPGHLPKWLQTWDFLPQWMHSLKPLDHFITRATLCC
ARPEPRSPPMPRRVFLEELPPATPSPHLAQPAHHTATRL
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgatgtcctatggtgagagactggggagcccagctgtctccccgctccccgtccgcggg
ggacatgtgatgcatggggcagcctttgcctatgtgcctagcccacaggtcctgcacagg
atcccagggacctccgcctatgccttccccagcctgggccctgtggccctcgccgagcac
agctgcccttacggggaggtcctggagctccatgatccgctgcctgccaagccggccctg
gaggaggagcagaagccagagcctgggttggcccagaggctccgccaggccagcaccaca
ctgctcaaggtgccactgatgctggccttcctctacctcttcgtctgctccctggatgtg
ctcagctcagccttccagctggctggagggaaggtggctggtgacatcttcaaggacaac
gccatcctctccaacccagtggctgggctggtggtgggcatcctggtgaccgtgctggtg
cagagttctagcacttctacctctatcatcgtcagcatggtctcctccggcttactggag
gtgagctctgccatccccatcattatgggctccaacattggcacctccgtcaccaacacc
attgtggccctaatgcaggcgggggacaggactgacttccggcgggcctttgcgggggcc
acagtacacgactgctttaactggctgtcagtgctggtcctactgcccctggaggctgcc
accggctacctgcaccatgtcactcggcttgtggtggcctccttcaacatctgtggcggc
cgagatgccccagacctgctcaagatcatcacggagcccttcactaagctcatcatccag
ctggacaagtccgtcattaccagcattgccactggtgatgagtccctgaggaaccacagc
ctcattcggacctggtgccacccagacctcctggaggctcacacctccacacccagtgta
gaggccaacagtagctggcatcttggaaatgccaccatggagaaatgcaaccacatcttt
gtggacacggggctgcctgacttggctgtggggctcattctgctggctggctccctggtg
ctcctgtgcacctgcctcatcctccttgtcaagatgctcaactccctgctcaagggccag
gtggccaaggtcattcagaaggttataaacaccgacttccccgtccccttcacctgggtc
acaggctactttgccatggtggtgggcgcaggcatgaccttcgttgtccaaagcagttcc
gtgttcacctccgccatcacgccgctcatcggcctgggtgtgatcagcatcgagcgagcc
taccctctcacgctgggctccaacattggcaccaccaccaccgccatcctggctgctctg
gccagccccagggagaagctgccgagtgccttccagattgccctctgccacttcttcttc
aacatctcgggcatcctgttgtggtatccagtgccctgcacacgcctgcccatccgcatg
gccaaggcactgggtaaacgcactgccaagtaccgctggtttgccgtcctctatctcctc
gtgtgcttcctgctgctaccctcgctggtattcggtatctccatggcaggctggcaggcc
atggtgggtgtgggcgctccctttggggccctgctggccttcatgggactcgtcagcttc
ctgcagagccgcagcccggggcacctgcccaagtggctgcagacatgggactttctgcca
caatggatgcactccctaaagcccctggaccacttcatcacccgcgccaccctgtgctgt
gccaggcccgagccccgttcgcccccgatgcccagaagggtcttcctggaggagctgccc
cctgccacgccctctccccacctagcgcagcctgctcaccacactgccactcgcctctag

KEGG   Loxodonta africana (African savanna elephant): 100676938
Entry
100676938         CDS       T04351                                 

Definition
(RefSeq) sodium-dependent phosphate transport protein 2B-like isoform X2
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100676938
  09154 Digestive system
   04978 Mineral absorption
    100676938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100676938
   04147 Exosome [BR:lav04147]
    100676938
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   100676938
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100676938
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 100676938
NCBI-ProteinID: XP_003421058
LinkDB
Position
Unknown
AA seq 692 aa
MAPWPEVENAQPDSKKYIEEVTSQQSAPHEKGEETAKNAPKNPLTKMKLLPSYSSMALIE
DLPEVEDPWDIPALKDMGIKWSERNTKEKILCVFQGIGKFIFLLGFLYLFVCSLDVLSSA
FQLVGGKVAGQLFSDNSILSNPVAGLVIGVLVTILVQSSSTSSSIIVSMVASSLLTVRAA
IPIIMGANIGTSITNTIVAFMQAGDQKEFRRAFAGATVHDFFNWLSVFVLLPLEAATHYL
EVLTNLVLESFHFKNGEDTPELLKVITDPFTKLIIQLDKKVINQIAMKDETAQNKSLVKI
WCQTFTNMTEMNVTVPSPENCTSPFLCFTDGLQFWATKNVTYNENIAKCQHIFVNFNLPD
VAIGIILLIISLLVLCTCLVMIVKLLNSVLKGQVAFVIKKTLNTDFPFPFAWLTGYLAIF
VGAGMTFIVQSSSVFTSAMTPLIGIGVITLERAYPLTLGSNIGTTTTSILAALASPGNTM
KSSLQIALCHFFFNVSGILLWYPIPLTRLPIRLAKGLGNISAKYRWFAIFYVVFLFFLVP
LTVFGLSLAGWQVLVGVGMPIIFLLLLVVFIQLLQSHCPHILPHKLQNWNFLPLWMHSLK
PWDHLISLLTSCCQRCCCCCCHLCCVLCGCPKCCRCNKYLEDLEEGQEYSKDTPIKTPNA
FDNMAISKESQDEVKFQVDTMGAKTISSSTAF
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggctccttggcctgaggtggaaaatgcccagccagactccaaaaaatacattgaagag
gtcactagtcagcagtccgccccacatgaaaaaggtgaagagactgctaaaaatgcaccc
aagaaccctctaaccaagatgaaacttctgccttcgtattccagtatggcactgattgaa
gacctcccagaggtggaagacccatgggacatacctgcacttaaggacatggggatcaag
tggtcagagagaaacaccaaagagaagattctatgtgtatttcaaggaattggaaaattc
attttccttctgggatttctctacttgtttgtgtgctccttggatgtcctcagcagtgcc
tttcagctggttggaggaaaagtagccgggcagctcttcagcgacaactctatcctgtcc
aaccctgtggcagggctggtgattggggtgctggtgaccatattggtgcagagctccagc
acctcctcgtccatcatcgtcagcatggttgcctcctcactgttgactgtgcgggctgcc
atccccatcatcatgggtgccaacattggaacctccatcaccaacaccattgtggcattc
atgcaggctggagaccagaaagagttccgaagggcttttgcaggtgccactgtccatgac
ttcttcaactggctgtctgtgttcgtgctcttgccccttgaggctgccacacattacctg
gaggtactgaccaaccttgtcttggagagcttccatttcaagaatggtgaagacaccccg
gaacttctgaaagtcatcacagatcccttcacaaagctcattatccagctggataaaaaa
gttatcaaccaaattgcgatgaaggatgaaacagcccaaaacaagagtttggtcaagatt
tggtgccagacttttaccaacatgactgagatgaatgtcactgtcccctcgccagagaac
tgcacttcccctttcctctgtttcacggatggtctccaattctgggccacgaagaatgtg
acctacaatgagaacatcgccaaatgtcagcacatctttgtgaatttcaacctcccggat
gttgccattggtattatcttgctgataatctccctgctggtcctctgcacctgcctggtc
atgattgtcaaactcctcaactctgtgctcaaggggcaggttgcttttgtcatcaagaag
accctcaacactgatttcccctttccctttgcctggttgactggctacttggccatcttc
gtgggggcaggaatgaccttcatcgtgcagagcagctctgtgttcacttctgccatgacc
ccgctaattggcatcggtgtgataactcttgagagggcatacccactcacgctgggctcc
aacattggcaccaccaccacttccatcctggctgctttagccagcccaggcaatactatg
aagagttcactccagattgccctgtgccacttcttcttcaacgtctctggcatcttgctg
tggtacccgataccactcacccgcctgcctatccgcctggccaagggactgggcaacatc
tctgccaagtatcgttggttcgccatcttctacgtggtcttcttattcttccttgtccca
ctgacagtgtttggcctttcactggctggctggcaagtgctagtgggtgtgggcatgccc
atcatcttcctgctgctgctggtggtgttcatccagctcctgcagtctcactgcccgcac
atcctgccccacaagctccagaactggaatttcctgcccctgtggatgcactcactgaag
ccctgggaccacctcatctccctgcttaccagctgctgccagaggtgctgctgctgctgc
tgccatctatgttgcgtgctgtgtggctgccccaagtgctgccgctgcaacaaatactta
gaggacctggaggagggacaggagtactctaaagacacccccatcaagacccccaatgcc
tttgataacatggccataagcaaagagtcccaggatgaggtcaagttccaagtcgatacc
atgggtgcaaagaccatctccagcagcacagccttttag

DBGET integrated database retrieval system